PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539310.1_FGP011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 865aa    MW: 95004.7 Da    PI: 6.5351
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539310.1_FGP011genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.75.7e-29550600252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sl++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  KN539310.1_FGP011 550 EKTVSLQVLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGINRWPSRKIKKV 600
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.734539620IPR003035RWP-RK domain
PfamPF020421.0E-25552600IPR003035RWP-RK domain
SuperFamilySSF542771.41E-20757853No hitNo description
PROSITE profilePS5174518.398767850IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.8E-24767848No hitNo description
SMARTSM006668.0E-18767850IPR000270PB1 domain
PfamPF005644.1E-15768848IPR000270PB1 domain
CDDcd064073.50E-43768848No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 865 aa     Download sequence    Send to blast
MEVGMAGFLC GAGSLNSEGN LTCMEEGDPQ PSISLARTPS EGTAAAVDLD LLEQLLSADN  60
AWLEVAANTS RSPNYFATPS NCLTDASVVT TTPANSWWIQ PSGASTSVRE RFDQALAYIR  120
ETQSDADVLV QLWVPVKGND GQLVLTTSGQ PFTLDQRSNS LIQFREVSTK YQFSADVASG  180
SSPGLPGRVF IGRLPEWSPD VRYFTSYEYP RISHAQYLDV HGTMGLPVFE RGNYSCLGVI  240
ELIMTKQKLN FTSELNTICS ALQAVNLTST EVSSIPRTKL NSASYKDALP EILEVLRAAC  300
ITHKLPLAQT WVTCAQQGKR GSRHSDENYK YCISTIDAAC YVNEPQMQSF HEACSEHHLL  360
RGQGVAGKAF TTNQPCFLPD IGSSTKLEYP LSHHAKIFNL KGAVAIRLRC TRTGIADFVL  420
EFFLPTDCEV LEEQKAVLDS LSGTMRSVCQ TLRVVTDKEM EDEAMREMNE LNSFSPRGKN  480
KVEELSFGDN TREDREETSW TTLVGTSQKG SDLAELHTHG MLSHGGQGSS QAGDQTSKEG  540
SKVKRRTKTE KTVSLQVLRQ YFAGSLKDAA KSLGVCPTTL KRICRQHGIN RWPSRKIKKV  600
DHSLRKLQQI IDSVHGAETA FQLNTLYKDL TNTSVSSDNN LSGSVTVPLA NQNNLDFEKH  660
QHHRLSSNIP STSLSHSSCS QSSDSSPSCS GGATKHSPQV GADQVRSGCL PQHSPVQTLQ  720
TEAASINEHF SGQEAPIDLL QDVAEKANGE QHMSQSPSSP KQTANVGMRV KVTFGSEKVR  780
FRLKPECDFQ ELKQEISKRL SIVDMNSLIV KYLDDDSEWV LMTCDADLHE CFHVYKLADI  840
QTIKISVHLA ASPTTRITIG HTGFS
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539310.1_FGP011
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0056790.0AP005679.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1210_A07.
GenBankAP0149650.0AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612115.10.0protein NLP1-like isoform X1
TrEMBLB9G4W80.0B9G4W8_ORYSJ; Uncharacterized protein
STRINGOBART09G18730.20.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55543852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein