PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539219.1_FGP007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 523aa    MW: 56856.6 Da    PI: 7.652
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539219.1_FGP007genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.41.3e-1820833499
                       SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                       +t+  +d +g +W++++iyr++++r++lt+GW+ Fv++++L +gD++vF   +++ +el+v+++r+
  KN539219.1_FGP007 20 QTVLAKDVHGVVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFL--RTRHGELCVGIRRA 83
                       379999********************************************..4479999*****97 PP

2Auxin_resp116.42.5e-38144227183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrl.sGtvvgvsdldpvrWpnSkWrsLk 83 
                        aa+ as++ +Fev Y+Prast+eFvvk+++v++a++++++ GmRfkmafetedss++++ +Gt+++v+ +dp rWpnS+Wr+L+
  KN539219.1_FGP007 144 AASLASSGLPFEVAYYPRASTPEFVVKAASVQAAMRIQWCSGMRFKMAFETEDSSRISWfMGTISSVQVADPNRWPNSPWRLLQ 227
                        68899*****************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.801184IPR003340B3 DNA binding domain
SMARTSM010192.1E-6384IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-23985IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-181085IPR015300DNA-binding pseudobarrel domain
CDDcd100174.61E-142082No hitNo description
PfamPF023621.3E-162083IPR003340B3 DNA binding domain
PfamPF065072.3E-33144227IPR010525Auxin response factor
PROSITE profilePS5174516.706459523IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MKEVGEVEEE LDYRADPPVQ TVLAKDVHGV VWKFRHIYRG TPRRHLLTTG WSTFVNQKKL  60
VAGDSIVFLR TRHGELCVGI RRAKRVACGG MECMSGWNAP GYGGGGGFSA FLKEEENKLM  120
KGHGGGGGYM KGKGKVRMAD VVEAASLASS GLPFEVAYYP RASTPEFVVK AASVQAAMRI  180
QWCSGMRFKM AFETEDSSRI SWFMGTISSV QVADPNRWPN SPWRLLQVTW DEPDLLQNVK  240
CVSPWLVELV SSIPPIHLGP FSSPRKKLRV PPHPDFPFEG HLLNPIFHGN PLGPSNSPLC  300
CYPDTAPAGI QGARHAQFGL PLTDHQLNKL HLGLLHSGSF NRLDAITPPS RISKGFVVSS  360
APAHDNVSCL LSIGTPQVAE KSDDRKTTPH IMLFGKAIFT EQQITSSGST ETLSPGVTGN  420
SSPNGNAHKT GNASDGSGSS ICIGFSSQGH EASDLGLEAG HCKVFMESED VGRTIDLSVF  480
GSYEELYGRL ADMFGIEKEE IINHLHFRDA AGVVKHPGEV PFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A2e-4211252187392Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539219.1_FGP007
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186170.0AK318617.1 Oryza sativa Japonica Group cDNA, clone: J100090H20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614842.10.0auxin response factor 22
SwissprotQ9AV470.0ARFV_ORYSJ; Auxin response factor 22
TrEMBLA0A0E0R0F80.0A0A0E0R0F8_ORYRU; Auxin response factor
STRINGORUFI10G14150.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51637152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30080.11e-171auxin response factor 16
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]