PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN539217.1_FGP001

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 66aa MW: 7023.9 Da PI: 3.993

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN539217.1_FGP001	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	37	7.9e-12	34	65	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+WT eEd llvd+++ +G g+W++ ar+ g KN539217.1_FGP001 34 RGPWTVEEDMLLVDYIANHGEGRWNSLARCAG 65 89***************************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.276	29	66	IPR017930	Myb domain
SuperFamily	SSF46689	5.46E-9	31	64	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.9E-11	32	65	IPR009057	Homeodomain-like
Pfam	PF00249	4.4E-9	34	66	IPR001005	SANT/Myb domain
CDD	cd00167	8.59E-7	36	66	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MEMEMMGMAM SPAMSSATAA AAAAASEDEG DLRRGPWTVE EDMLLVDYIA NHGEGRWNSL 60 ARCAGT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN539217.1_FGP001

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC118288	1e-69	AC118288.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0077L08, complete sequence.
GenBank	AK243659	1e-69	AK243659.1 Oryza sativa Japonica Group cDNA, clone: J100089B08, full insert sequence.
GenBank	AP014961	1e-69	AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBank	CP012613	1e-69	CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015638460.1	1e-23	transcription factor MYB2-like
Swissprot	Q10MB4	1e-16	MYB2_ORYSJ; Transcription factor MYB2
TrEMBL	A0A0E0KY62	1e-35	A0A0E0KY62_ORYPU; Uncharacterized protein
STRING	OPUNC05G02190.1	2e-36	(Oryza punctata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP27133	4	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49620.2	2e-16	myb domain protein 78

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774]