PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539017.1_FGP012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 932aa    MW: 103027 Da    PI: 6.3877
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539017.1_FGP012genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.62.9e-29578628252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  KN539017.1_FGP012 578 EKSVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKIKKV 628
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.348567648IPR003035RWP-RK domain
PfamPF020424.2E-26581628IPR003035RWP-RK domain
SuperFamilySSF542776.54E-23825919No hitNo description
Gene3DG3DSA:3.10.20.2401.2E-23831912No hitNo description
PfamPF005647.5E-18834915IPR000270PB1 domain
SMARTSM006661.2E-24834916IPR000270PB1 domain
PROSITE profilePS5174525.146834916IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 932 aa     Download sequence    Send to blast
MDGGGTPDGD PVPDMDMLML SSALDGLDSY TDLVAGSSVA DSIFSALTCF PPSQERLLHV  60
STPVGSNSRQ DDSDVSITKE GTTTRRGDCA AGLASGEPVA AGIGSVPKPF DGVTLTERML  120
RALAMLKEAS GGEAILVQVW MPVRNGEQHV LTTSDQPFLL DQKLTGYREV SRQFTFSAEE  180
GPGLFPGLPG RVFMSGMPEW TSNVMYYHGS EYLRVDYARR HEVRGSLAMP VFNSSGGSCC  240
AVLEVVMTRE KDNFCLEMVN VSNALQAFNN PLFLLCAAQR YAQLQCNTAK YLFKELSTSV  300
QLSTVNAWRH SQSYSRDQKL ALMEIFDVLQ AVCQAHLLPL ALAWIPVCSK RDVLVSVEYG  360
ANFGKRNKEV LCIEESACYV NDTRMRDFVQ VCAEHPLEKG QGVAGNAYLS NNPFFSSDVK  420
DYDMHAYPLV NHARKFGLHA AVAIRLRSTY TKNDDYVLEF FLPVLCKGGG EQQLLLDSIS  480
ATMRKVCKSL RTVSDAELKE DVTRKPSNEN RSGTRCPSPV NLIYSGREID VTNETKTNTP  540
LEYQIEGIDE QLSDTKSTNK LIKCSNASDG EKRRSSTEKS VSLSVLQQYF SGSLKDAAKS  600
IGVCPTTLKR ICRQHGISRW PSRKIKKVNR SLKKIQNVIS SVHGVEGVLK YDPSTGCLVS  660
SVSPSIEPVL MNVEHKGSDP LPIESELPHL NFEPDCDAYR REHAGQDVLH KLQNKQNGEI  720
NFDMDDGELF RNSHSTRTLS GAFCEDMPNG LYVAREMTCV AKTGTRTERL EHKPSSRDSF  780
SAPQEYRMES ETDKSNKNSK QSLPSSSSMT DCSTSSGETF KSIKSQSANE SNTTVVVKAS  840
YKNDTIRFKL LPSMKYEQLL EEIAKRLKLS VGVFQLKYKD DEGDWVILAS DADLQECLEI  900
LDTTRLHILK LQMQDVVCPI GSSSGSCSML RP
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539017.1_FGP012
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0648590.0AK064859.1 Oryza sativa Japonica Group cDNA clone:J013000H14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015616880.10.0protein NLP2-like isoform X1
RefseqXP_015616881.10.0protein NLP2-like isoform X1
TrEMBLB9GA830.0B9GA83_ORYSJ; Uncharacterized protein
STRINGOBART11G09000.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein