PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538926.1_FGP012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 933aa    MW: 102975 Da    PI: 6.4398
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538926.1_FGP012genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.74.6e-23127228199
                        EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                        f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   
  KN538926.1_FGP012 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI-- 214
                        99*****************************96555444..8************************************************.. PP

                        SSSEE..EEEEE-S CS
                 B3  86 grsefelvvkvfrk 99 
                        ++++ +l+++++r+
  KN538926.1_FGP012 215 RDEKSQLLLGIRRA 228
                        45677789999997 PP

2Auxin_resp123.12e-40253335183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
  KN538926.1_FGP012 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 335
                        79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-40119242IPR015300DNA-binding pseudobarrel domain
CDDcd100174.48E-20126227No hitNo description
SMARTSM010195.1E-23127229IPR003340B3 DNA binding domain
PfamPF023624.3E-21127228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.224127229IPR003340B3 DNA binding domain
PfamPF065073.3E-35253335IPR010525Auxin response factor
PfamPF023095.7E-9813904IPR033389AUX/IAA domain
PROSITE profilePS5174524.473818902IPR000270PB1 domain
SuperFamilySSF542773.24E-7836897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MKDQGSSGVS PAPGEGEKKA INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMHK  60
ELDNIPGYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYDRDAM LASELGLKQN  120
KQPAEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELIAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRATR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDPVRWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLAD DFALKDVQSA LFPGLSLVQW  420
MAMQQNPQML TAASQTVQSP YLNSNALAMQ DVMGSSNEDP TKRLNTQAQN TVLPNLQHKL  480
KEQTSGGQVA SQAQMLNQIF PPSSSQLQQL GLPKSPTHRQ GLTGLPIAEV QLQLLQKIQQ  540
QNMLSQLNPQ HQSQLIQQLS QKSQEILQQQ ILQHQFGGSD SIGQLKQSPS QQAPLNHMTG  600
SLTPQQLVRS HSALAESGDP SSSTAPSASR ISPINSLSRA NQGSRNLTDM VATPQIDNLL  660
QEIQSKPDNR IKNDIQSKET VPIHNRHPVS DQLDASSATS FCLDESPREG FSFPPVCLDN  720
NVQVDPRDNF LIAENVDALM PDALLSRGMA SGKGMCTLTS GQRDHRDVEN ELSSAAFSSQ  780
SFGVPDMSFK PGCSSDVAVT DAGMPSQGLW NNQTQRMRTF TKVQKRGSVG RSIDITRYRD  840
YDELRHDLAC MFGIQGQLED PYRMDWKLVY VDHENDILLV GDDPWEEFVG CVKSIKILSA  900
AEVQQMSLDG DLGGVPPQTQ ACSASDDANA WRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1641735647388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538926.1_FGP012
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under dark condition. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1033270.0AK103327.1 Oryza sativa Japonica Group cDNA clone:J033125L14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643020.10.0auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A453R1770.0A0A453R177_AEGTS; Auxin response factor
STRINGORUFI06G06450.10.0(Oryza rufipogon)
STRINGONIVA06G07160.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90453338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Shen C, et al.
    OsARF16, a transcription factor, is required for auxin and phosphate starvation response in rice (Oryza sativa L.).
    Plant Cell Environ., 2013. 36(3): p. 607-20
    [PMID:22913536]
  2. Shen C, et al.
    OsARF16 is involved in cytokinin-mediated inhibition of phosphate transport and phosphate signaling in rice (Oryza sativa L.).
    PLoS ONE, 2014. 9(11): p. e112906
    [PMID:25386911]
  3. Shen C, et al.
    OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.).
    Plant Sci., 2015. 231: p. 148-58
    [PMID:25576000]