PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN538915.1_FGP017 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 94aa MW: 10969.6 Da PI: 10.77 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 99.6 | 4.4e-31 | 5 | 79 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl KN538915.1_FGP017 5 GEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAENNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 79 789**********************************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 33.64 | 1 | 94 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.57E-32 | 3 | 85 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-13 | 9 | 79 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MAAIGEKEWF FYVPRDRKYR NGDRPNRVTA SGYWKATGAD RMIRAENNRP IGLKKTLVFY 60 SGKAPKGVRS SWIMNEYRLP PADTDRYHKV PIHP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-33 | 2 | 79 | 66 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swm_B | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swm_C | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swm_D | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_A | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_B | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_C | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
3swp_D | 1e-32 | 2 | 79 | 69 | 145 | NAC domain-containing protein 19 |
4dul_A | 9e-33 | 2 | 79 | 66 | 142 | NAC domain-containing protein 19 |
4dul_B | 9e-33 | 2 | 79 | 66 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN538915.1_FGP017 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP003346 | 1e-151 | AP003346.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0434C04. | |||
GenBank | AP003431 | 1e-151 | AP003431.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1099D03. | |||
GenBank | AP014957 | 1e-151 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012609 | 1e-151 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015695832.1 | 2e-59 | PREDICTED: NAC transcription factor ONAC010 | ||||
Swissprot | Q9ZVP8 | 2e-51 | NAC35_ARATH; NAC domain-containing protein 35 | ||||
TrEMBL | A0A0D9V8R6 | 2e-58 | A0A0D9V8R6_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR01G34330.2 | 3e-59 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2826 | 37 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02450.2 | 1e-53 | NAC domain containing protein 35 |
Publications ? help Back to Top | |||
---|---|---|---|
|