PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538737.1_FGP044
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 677aa    MW: 75568.1 Da    PI: 6.6191
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538737.1_FGP044genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK901.9e-28355405252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  KN538737.1_FGP044 355 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 405
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029344425IPR003035RWP-RK domain
PfamPF020424.6E-26357405IPR003035RWP-RK domain
SuperFamilySSF542776.62E-23577661No hitNo description
Gene3DG3DSA:3.10.20.2407.1E-26577661No hitNo description
PROSITE profilePS5174523.255579662IPR000270PB1 domain
SMARTSM006662.0E-25579662IPR000270PB1 domain
PfamPF005647.4E-18580661IPR000270PB1 domain
CDDcd064071.21E-43580661No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MTTQKVNYSA EIENICNALK EVDLRSSDVS SDPRSKVVDA SYRAIIPEIM DVLRAVCDTH  60
NLPLAQTWIP CICQAKRGSR HSDESYKHCV STVDEACYVR DRSVLGFHQA CSEHHLFRGE  120
GVVGRAFGTN EPCFSPDITT YSKTQYPLSH HAKLFGLRAA VAIRLRSVKT GSLDFVLEFF  180
LPMKCINTEE QRAMLNSLSN TIQQVCYTLR VVKPKELVND GPFEISQPTR PEFYAKSVHE  240
NMDELCSGIN VPGRTTSLEA SEEVSSWIAS LVDAQNKGGK GEIDVDLPFG FSKQDDEGFS  300
VTAGWHTSPV MAPDGSMFSG FKRHEDYDVN ENTCSSDPSN SNSDKAVEKR RTKTEKTVSL  360
QDLRKHFAGS LKEAAKNLGV CPTTLKRICR QHGINRWPSR KIKKVGHSLK KLQMVIDSVH  420
GPEGTVQLSS LYENFTKTTW SERELQGDVH FPASEQNFQL EPSVPDRPCE GRFTSHTSGS  480
NSISPSCSQS SNSSLGCSSV PKTQQQHGSA PQLAVKEEIS MDENQCSTLI KSASHAEAEL  540
QMFVEERPTM LFRSQSQVLL SEHKPIENMS NVQKARSDSL KIKAIYGEER CIFRLQPSWG  600
FQRLKEEIVK RFGISQDTHV DLKYLDDESE WVLLTCDADL LECIDVYKSS SNQTVRILVN  660
PSIQPLLNAS FGQTGLS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538737.1_FGP044
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629744.10.0protein NLP1
RefseqXP_015629745.10.0protein NLP1
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A0D9Z1N00.0A0A0D9Z1N0_9ORYZ; Uncharacterized protein
STRINGOGLUM03G02410.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-159Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]