PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538722.1_FGP035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 232aa    MW: 27218.1 Da    PI: 5.1036
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538722.1_FGP035genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.7e-28109159252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek +++e +s+yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  KN538722.1_FGP035 109 EKALTFELVSQYFYMPITQAARELNVGLTLLKKKCRELGIPRWPHRKMKSL 159
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.97495179IPR003035RWP-RK domain
PfamPF020427.0E-22112159IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEPSQEHSWW PYCTSLCPDS YLLEEEALFS SLSFPSFHPQ PVYSTVMQSN VLQDELGVIF  60
EDDVLKYWDE MEQSENKVEK SEKGLPLLYY GDENGAASKI MRDDVRSEEK ALTFELVSQY  120
FYMPITQAAR ELNVGLTLLK KKCRELGIPR WPHRKMKSLQ TLINNVQVLQ EASKANNEEQ  180
LRMLVEMLQE ERRLLEQKPY VQLEEKTKRL RQACFKANYK KRRLLALEAG EP
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN538722.1_FGP035
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035090.0AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
GenBankAP0035690.0AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641922.11e-170protein RKD1 isoform X2
SwissprotQ9M9U91e-43RKD1_ARATH; Protein RKD1
TrEMBLA0A0P0WU771e-168A0A0P0WU77_ORYSJ; Os06g0228950 protein
STRINGOS06T0228950-001e-169(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-37RWP-RK domain-containing protein