PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01037826.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 90aa    MW: 10226 Da    PI: 11.5438
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01037826.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.91.3e-25454252
                 RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                           +k+++l d++ yF+lpi++AAk+L++c+T+LK iCR++G+ RWP+Rk++s+
  AMDW01037826.1_FGP001  4 TKQLRLGDIAPYFELPIAKAAKKLDICATALKGICRKHGVLRWPYRKVRSI 54
                           89**********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.2176IPR003035RWP-RK domain
PfamPF020421.2E-21754IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
REKTKQLRLG DIAPYFELPI AKAAKKLDIC ATALKGICRK HGVLRWPYRK VRSIDRQIAT  60
LRRSGNGDAT RNEIQTLIAS RRRIVAGLDQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapAMDW01037826.1_FGP001
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL8318063e-74AL831806.5 Oryza sativa chromosome 12, . BAC OSJNBb0106P21 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL9541603e-74AL954160.5 Oryza sativa chromosome 12, . BAC OSJNBb0078J08 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149683e-74AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664445.15e-42PREDICTED: uncharacterized protein LOC102713973
TrEMBLQ2QVF71e-54Q2QVF7_ORYSJ; RWP-RK domain containing protein
STRINGORUFI12G07480.12e-55(Oryza rufipogon)
STRINGORGLA12G0062200.12e-55(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.15e-14NIN like protein 7