PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AMDW01037211.1_FGP001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 139aa MW: 15120 Da PI: 5.6523 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 137.2 | 1.8e-42 | 1 | 132 | 241 | 374 |
GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328 +veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er++vE++ll+rei+nv+a g +r+ + + +++Wre+l ++GF+ + AMDW01037211.1_FGP001 1 MVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRVSS 86 699****9.899****************************************************999987.***************** PP GRAS 329 lsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 l +aa+qa lll +++sdgy++ ee+g+l lgWkd L+++SaWr AMDW01037211.1_FGP001 87 LAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAWR 132 *********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 6.2E-40 | 1 | 132 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 19.856 | 1 | 112 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MVEQDLSHSG SFLARFVEAI HYYSALFDSL DASYSEDSPE RHVVEQQLLS REIRNVLAVG 60 GPARTGDVKF GSWREKLAQS GFRVSSLAGS AAAQAALLLG MFPSDGYTLI EENGALKLGW 120 KDLCLLTASA WRPIQASGR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 5e-72 | 1 | 133 | 248 | 380 | Protein SCARECROW |
5b3h_A | 5e-72 | 1 | 133 | 247 | 379 | Protein SCARECROW |
5b3h_D | 5e-72 | 1 | 133 | 247 | 379 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for cell division but not differentiation of the ground tissue. Regulates the radial organization of the shoot axial organs. Restricts SHR movment and sequesters it into the nucleus of the endodermis (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AMDW01037211.1_FGP001 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012619 | 0.0 | CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015620600.1 | 4e-93 | protein SCARECROW 2 | ||||
Swissprot | A2ZAX5 | 3e-94 | SCR1_ORYSI; Protein SCARECROW 1 | ||||
TrEMBL | A0A0E0IXM3 | 5e-95 | A0A0E0IXM3_ORYNI; Uncharacterized protein | ||||
STRING | ONIVA11G01600.1 | 8e-96 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1371 | 38 | 122 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54220.1 | 6e-62 | GRAS family protein |