PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORGLA05G0230300.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 144aa MW: 15587.5 Da PI: 4.6378 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 173.1 | 3e-54 | 22 | 118 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 +eqdrflPian++rim++++P+n+ki+kd+ke+vqecvsefisf+tseasdkc +ekrktingddl+w+++tlGfedyveplk+yl+ yre+ ORGLA05G0230300.1 22 KEQDRFLPIANIGRIMRRAVPENGKIAKDSKESVQECVSEFISFITSEASDKCLKEKRKTINGDDLIWSMGTLGFEDYVEPLKLYLRLYRET 113 89****************************************************************************************** PP NF-YB 94 egekk 98 eg++k ORGLA05G0230300.1 114 EGDTK 118 **975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.7E-48 | 21 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.92E-37 | 24 | 120 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.1E-26 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-19 | 55 | 73 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 58 | 74 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-19 | 74 | 92 | No hit | No description |
PRINTS | PR00615 | 4.7E-19 | 93 | 111 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MSEGFDGTEN GGGGGGGGGV GKEQDRFLPI ANIGRIMRRA VPENGKIAKD SKESVQECVS 60 EFISFITSEA SDKCLKEKRK TINGDDLIWS MGTLGFEDYV EPLKLYLRLY RETEGDTKGS 120 RASELPVKKD VVLNGDPGSS FEGM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 4e-46 | 22 | 112 | 3 | 93 | NF-YB |
4awl_B | 4e-46 | 22 | 112 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 4e-46 | 22 | 112 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | ORGLA05G0230300.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT837975 | 0.0 | CT837975.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA013H22, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015638071.1 | 1e-89 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | Q65XK1 | 9e-91 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | I1PY55 | 5e-99 | I1PY55_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA05G0230300.1 | 1e-100 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 8e-59 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|