PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA04G0263900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YC
Protein Properties Length: 125aa    MW: 13251.1 Da    PI: 9.1825
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA04G0263900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC83.91.9e-26541163799
              NF-YC  37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                        +mis eaPv++skacelfi elt r+w  + e krrt++k d+aaav++td fdflvd+v  d
  ORGLA04G0263900.1  54 RMISGEAPVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTAD 116
                        8**********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.27E-2418109IPR009072Histone-fold
Gene3DG3DSA:1.10.20.108.3E-3119101IPR009072Histone-fold
PfamPF008083.0E-1252100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MRQARPYSAM FAGGVSARTG PHALPLARIK KIMKRSAGDS SVVDGGGGGG GGTRMISGEA  60
PVVFSKACEL FIAELTRRAW AATLEGKRRT VHKEDVAAAV QNTDLFDFLV DVVTADLGDD  120
HTDYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B7e-31221131693NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapORGLA04G0263900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880470.0AB288047.1 Oryza sativa Japonica Group OsHAP5G gene for HAP5 subunit of HAP complex, complete cds.
GenBankAL6066410.0AL606641.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0032F06, complete sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635297.13e-86nuclear transcription factor Y subunit C-2
SwissprotQ8LCG75e-30NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
SwissprotQ9ZVL38e-30NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLA0A0D3G1W11e-85A0A0D3G1W1_9ORYZ; Uncharacterized protein
TrEMBLI1PR201e-85I1PR20_ORYGL; Uncharacterized protein
STRINGORGLA04G0263900.12e-86(Oryza glaberrima)
STRINGOBART04G30090.12e-86(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116583339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.27e-31nuclear factor Y, subunit C2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Li S, et al.
    HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis.
    Plant Cell, 2014. 26(4): p. 1764-1780
    [PMID:24728648]
  3. Mei X, et al.
    Identification and characterization of paternal-preferentially expressed gene NF-YC8 in maize endosperm.
    Mol. Genet. Genomics, 2015. 290(5): p. 1819-31
    [PMID:25851237]
  4. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  5. Baud S, et al.
    Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed.
    Plant Physiol., 2016. 171(2): p. 1099-112
    [PMID:27208266]
  6. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  7. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  8. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  9. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  10. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  11. Gnesutta N, et al.
    CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
    Plant Cell, 2017. 29(6): p. 1516-1532
    [PMID:28526714]