PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORGLA02G0269000.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 249aa MW: 27006.5 Da PI: 5.0146 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 45.4 | 1.9e-14 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed++lv G +W+++++ g+ R++k+c++rw +yl ORGLA02G0269000.1 14 KGPWTADEDQKLVTFLLSNGHCCWRLVPKLAGLLRCGKSCRLRWTNYL 61 79******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 57.8 | 2.4e-18 | 70 | 111 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++eE++l +d+++qlG++ W++Ia++++ gRt++++k++w+++ ORGLA02G0269000.1 70 LSEEEEKLVIDLHEQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111 69*****************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.2E-19 | 5 | 63 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.881 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.11E-27 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.7E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.80E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.855 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-25 | 64 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.9E-16 | 70 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.79E-13 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MGRQPCCEKV GLKKGPWTAD EDQKLVTFLL SNGHCCWRLV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL SEEEEKLVID LHEQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLKKMG 120 LDPVTHRPVM SLAQPDPLKQ QQEPSVSGGT GADDKEEEEE TPTSAQPQGV ACAASSASAV 180 SSSCSSSASA SAATPGADVD WPGLFEVDAI LDIDWAGLLS ACGDDGGCSA IGIDFDQCSD 240 VGFDQDVWM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-30 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. | |||||
UniProt | Transcription factor that acts as positive regulator of abscisic acid (ABA) signaling in response to salt stress. Acts as negative regulator ABI1, ABI2 and PP2CA, which are protein phosphatases 2C acting as negative regulator of ABA signaling. Binds to the DNA specific sequence and core element 5'-ACGT-3' found in the promoters of ABI1 and PP2CA to negatively regulate their expression during ABA-dependent salt stress response. {ECO:0000269|PubMed:23660402}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | ORGLA02G0269000.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. | |||||
UniProt | INDUCTION: Induced by salt stress, drought stress and abscisic acid (ABA). Down-regulated by salicylic acid (SA) methyl jasmonate (JA). {ECO:0000269|PubMed:23660402}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK108709 | 0.0 | AK108709.1 Oryza sativa Japonica Group cDNA clone:002-150-A10, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015624871.1 | 1e-154 | protein ODORANT1 | ||||
Swissprot | Q50EX6 | 2e-82 | ODO1_PETHY; Protein ODORANT1 | ||||
Swissprot | Q9C7U7 | 1e-82 | MYB20_ARATH; Transcription factor MYB20 | ||||
TrEMBL | I1P3Y4 | 0.0 | I1P3Y4_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA02G0269000.1 | 0.0 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66230.1 | 9e-84 | myb domain protein 20 |
Publications ? help Back to Top | |||
---|---|---|---|
|