PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G25980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 106aa    MW: 11591.1 Da    PI: 11.4944
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G25980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.5e-0946821147
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
     OB05G25980.1 46 LFLEGLEKYGRGDWRNISRGSVKTRTPTQVASHAQKF 82
                     8**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-104586IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-104586IPR006447Myb domain, plants
CDDcd001672.19E-74583No hitNo description
Gene3DG3DSA:1.10.10.607.1E-64678IPR009057Homeodomain-like
PfamPF002491.0E-54681IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MSTPTGLKPD GDSLLGRIYS ENDGTRARRG NRNGACGKIA CAGMRLFLEG LEKYGRGDWR  60
NISRGSVKTR TPTQVASHAQ KFFTRQANAG RRGDAKRKSI HDITAP
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB05G25980.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679541e-52AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692615.14e-34PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H74e-21DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLJ3M7M43e-72J3M7M4_ORYBR; Uncharacterized protein
STRINGOB05G25980.16e-73(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.15e-24MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]