PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OB05G24820.1

Organism

Oryza brachyantha

Taxonomic ID

4533

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NAC

Protein Properties

Length: 314aa MW: 35417.2 Da PI: 9.9253

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OB05G24820.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.5	3.7e-51	18	142	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 lppGfrFhPtdeelvv+yL+++++g ++ + +i+evd+yk++Pw+Lp+++ +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v + OB05G24820.1 18 LPPGFRFHPTDEELVVHYLCRRCAGLPVAV-PIIAEVDLYKYDPWQLPRMALYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT--P 111 79***********************999.88***********7666789*********************************99..7 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 + v +kk Lvfy g+apkg kt+W+mheyrl OB05G24820.1 112 RPVAIKKALVFYAGKAPKGDKTNWIMHEYRL 142 79*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	9.55E-62	13	168	IPR003441	NAC domain
PROSITE profile	PS51005	59.567	18	168	IPR003441	NAC domain
Pfam	PF02365	3.1E-26	19	142	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 314 aa Download sequence Send to blast
MSGGGAGGAA AERQELQLPP GFRFHPTDEE LVVHYLCRRC AGLPVAVPII AEVDLYKYDP 60 WQLPRMALYG EKEWYFFSPR DRKYPNGSRP NRAAGSGYWK ATGADKPVGT PRPVAIKKAL 120 VFYAGKAPKG DKTNWIMHEY RLADVDRSAR KKNSLRLDDW VLCRIYNKKG GLEKPIGGXX 180 XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXYD VLRPSVSMPR AHADSSCSEH 240 VLTTSASSCG AQRPGXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX 300 XXXXELGGVT RASR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-78	15	174	12	174	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269\|PubMed:17587305, ECO:0000269\|PubMed:18273684, ECO:0000269\|PubMed:19453457, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	OB05G24820.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269\|PubMed:11332734, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT037323	0.0	BT037323.1 Zea mays full-length cDNA clone ZM_BFb0162P01 mRNA, complete cds.
GenBank	KJ727956	0.0	KJ727956.1 Zea mays clone pUT6054 NAC transcription factor (NAC20) mRNA, partial cds.
GenBank	KM987612	0.0	KM987612.1 Zea mays NAC protein (SNAC052) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015692607.1	1e-128	PREDICTED: NAC domain-containing protein 48-like
Swissprot	Q7F2L3	1e-119	NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBL	J3M7A8	1e-141	J3M7A8_ORYBR; Uncharacterized protein
STRING	OB05G24820.1	1e-142	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3417	37	82

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-104	NAC family protein

Publications ? help Back to Top
Xiong L,Lee MW,Qi M,Yang Y Identification of defense-related rice genes by suppression subtractive hybridization and differential screening. Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92 [PMID:11332734] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ohnishi T, et al. OsNAC6, a member of the NAC gene family, is induced by various stresses in rice. Genes Genet. Syst., 2005. 80(2): p. 135-9 [PMID:16172526] Hu H, et al. Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice. Plant Mol. Biol., 2008. 67(1-2): p. 169-81 [PMID:18273684] Kim MJ, et al. Quadruple 9-mer-based protein binding microarray with DsRed fusion protein. BMC Mol. Biol., 2009. 10: p. 91 [PMID:19761621] Chung PJ,Kim JK Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth. Plant Signal Behav, 2009. 4(7): p. 675-7 [PMID:19820307] Peng HF, et al. Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.). Theor. Appl. Genet., 2010. 120(5): p. 1013-20 [PMID:20012261] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Kim MJ, et al. Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein. Methods Mol. Biol., 2012. 786: p. 65-77 [PMID:21938620] Gupta SK, et al. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice. J. Exp. Bot., 2012. 63(2): p. 757-72 [PMID:22058403] Nakashima K, et al. Comparative functional analysis of six drought-responsive promoters in transgenic rice. Planta, 2014. 239(1): p. 47-60 [PMID:24062085] Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice. Rice (N Y), 2012. 5(1): p. 6 [PMID:24764506] Qian B, et al. Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+). J. Plant Physiol., 2015. 175: p. 9-20 [PMID:25460871] Shiriga K, et al. Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize. Meta Gene, 2014. 2: p. 407-17 [PMID:25606426] Farooq MA,Detterbeck A,Clemens S,Dietz KJ Silicon-induced reversibility of cadmium toxicity in rice. J. Exp. Bot., 2016. 67(11): p. 3573-85 [PMID:27122572] Lee DK, et al. The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance. Plant Biotechnol. J., 2017. 15(6): p. 754-764 [PMID:27892643]