PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OB05G14050.1

Organism

Oryza brachyantha

Taxonomic ID

4533

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 164aa MW: 18022.7 Da PI: 10.1052

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OB05G14050.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	40.1	8.5e-13	23	67	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r rW+ eE++++++a ++G + Wk+I + ++t+ q++s+ qk+ OB05G14050.1 23 RERWSGEEHDRFLHALMLFGRD-WKRIEGFVA-TKTAIQIRSHAQKH 67 78****************77.*****.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	9.72E-16	17	73	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.842	18	72	IPR017930	Myb domain
SMART	SM00717	8.3E-9	22	70	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	3.9E-15	22	70	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	4.9E-7	23	67	IPR009057	Homeodomain-like
Pfam	PF00249	8.7E-10	23	67	IPR001005	SANT/Myb domain
CDD	cd00167	1.20E-7	25	68	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
MAAMAGPGGG GEGGGPYTIT RPRERWSGEE HDRFLHALML FGRDWKRIEG FVATKTAIQI 60 RSHAQKHFLK ARKFGPPGAP PPPLHPRRAT PPACYAYSPE DSFRPLIQSN DLGFAQVYKF 120 VGDVFGSGEP RPVEAHLRRL HGMDPAISET ILLVLRNLAA NLCA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:21474993, ECO:0000269\|PubMed:21483796, ECO:0000269\|PubMed:23638299}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	OB05G14050.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:22902701, ECO:0000269\|PubMed:23638299}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC124144	2e-46	AC124144.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0099P06, complete sequence.
GenBank	AP014961	2e-46	AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBank	CP012613	2e-46	CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006655018.2	5e-90	PREDICTED: protein REVEILLE 5-like
Swissprot	Q8RWU3	7e-27	RVE8_ARATH; Protein REVEILLE 8
TrEMBL	J3M481	1e-117	J3M481_ORYBR; Uncharacterized protein
STRING	OB05G14050.1	1e-118	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3642	31	70

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G09600.1	1e-24	MYB_related family protein

Publications ? help Back to Top
Manfield IW, et al. Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Fogelmark K,Troein C Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] Xing H, et al. LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]