PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB05G14050.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 164aa MW: 18022.7 Da PI: 10.1052 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.1 | 8.5e-13 | 23 | 67 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r rW+ eE++++++a ++G + Wk+I + ++t+ q++s+ qk+ OB05G14050.1 23 RERWSGEEHDRFLHALMLFGRD-WKRIEGFVA-TKTAIQIRSHAQKH 67 78******************77.*********.************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 9.72E-16 | 17 | 73 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.842 | 18 | 72 | IPR017930 | Myb domain |
SMART | SM00717 | 8.3E-9 | 22 | 70 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 3.9E-15 | 22 | 70 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 4.9E-7 | 23 | 67 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 8.7E-10 | 23 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.20E-7 | 25 | 68 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MAAMAGPGGG GEGGGPYTIT RPRERWSGEE HDRFLHALML FGRDWKRIEG FVATKTAIQI 60 RSHAQKHFLK ARKFGPPGAP PPPLHPRRAT PPACYAYSPE DSFRPLIQSN DLGFAQVYKF 120 VGDVFGSGEP RPVEAHLRRL HGMDPAISET ILLVLRNLAA NLCA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB05G14050.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC124144 | 2e-46 | AC124144.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0099P06, complete sequence. | |||
GenBank | AP014961 | 2e-46 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012613 | 2e-46 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006655018.2 | 5e-90 | PREDICTED: protein REVEILLE 5-like | ||||
Swissprot | Q8RWU3 | 7e-27 | RVE8_ARATH; Protein REVEILLE 8 | ||||
TrEMBL | J3M481 | 1e-117 | J3M481_ORYBR; Uncharacterized protein | ||||
STRING | OB05G14050.1 | 1e-118 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3642 | 31 | 70 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09600.1 | 1e-24 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|