PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G26810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 274aa    MW: 29664 Da    PI: 6.0353
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G26810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d++ ++G g+W++++ + g+ R +k+c++rw +yl
     OB04G26810.1 15 KGLWSPEEDQKLRDYILRYGHGCWSAVPVKAGLERNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding50.64.5e-1669113248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g ++ eE+e   ++++ +G++ W+ Iar+++ gRt++++k++w++yl
     OB04G26810.1  69 GMFSREEEETVMNLHATMGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113
                      56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-211065IPR009057Homeodomain-like
PROSITE profilePS5129414.1871062IPR017930Myb domain
SuperFamilySSF466891.5E-2813109IPR009057Homeodomain-like
SMARTSM007171.1E-111464IPR001005SANT/Myb domain
PfamPF002491.7E-131562IPR001005SANT/Myb domain
CDDcd001671.67E-101862No hitNo description
PROSITE profilePS5129424.27363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2566116IPR009057Homeodomain-like
SMARTSM007176.1E-1467115IPR001005SANT/Myb domain
PfamPF002491.9E-1469113IPR001005SANT/Myb domain
CDDcd001674.53E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGCKACQKPK VHYRKGLWSP EEDQKLRDYI LRYGHGCWSA VPVKAGLERN GKSCRLRWIN  60
YLRPGLKHGM FSREEEETVM NLHATMGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGT  120
QAPARKSAEP ADVTGSPNSS ETGQERAVAE QPASSDSSEP VESSSADDSS CLTEPAAGAG  180
AGFAAVRPHA PVIPKVMFAD WFDMDYGTSL PGTAPGLSHQ CSSSVQVDGP CGAVDSLHGL  240
GDGGFCWDFD DAADHMQGGG LSDLLSMSEF LGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25151187109B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G26810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071350.0AK107135.1 Oryza sativa Japonica Group cDNA clone:002-124-C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691915.10.0PREDICTED: transcription factor LAF1-like
TrEMBLJ3LZV60.0J3LZV6_ORYBR; Uncharacterized protein
STRINGOB04G26810.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.15e-59myb domain protein 19