PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G46940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 167aa    MW: 17999.4 Da    PI: 11.7944
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G46940.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.75.7e-081081441147
                      HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      l++++  ++G g+W+ I+r    +Rt+ q+ s+ qky
     OB01G46940.1 108 LFLEGLDRYGRGDWRNISRFAVRTRTPTQVASHAQKY 144
                      89**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.1E-11106149IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-11107148IPR006447Myb domain, plants
CDDcd001672.35E-6107145No hitNo description
Gene3DG3DSA:1.10.10.602.1E-5107143IPR009057Homeodomain-like
PfamPF002496.0E-6108144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MTVTTAAAAP ASPAARSAAA AYPGPKTSTG VDRKHLKPSP PFFLLSANFC SGSFSISRFV  60
SALPRQSGEA NKFLSAGRWG PPASHPDSNR LSACVKLTSS VPPCVRRLFL EGLDRYGRGD  120
WRNISRFAVR TRTPTQVASH AQKYFIRQAN AGARDSKRKS IHDITTP
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G46940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0036111e-133AP003611.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0423B08.
GenBankAP0149571e-133AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126091e-133CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3L6381e-117J3L638_ORYBR; Uncharacterized protein
STRINGOB01G46940.11e-118(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-24MYB family protein