PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB01G45050.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 189aa MW: 20963.7 Da PI: 8.0331 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 177.4 | 1.3e-55 | 19 | 115 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 vreqdrflPian+srimkk++Pan+ki+kdaket+qecvsefisfvtseasdkcq+ekrkting+dll+a++tlGfe+yvepl++yl+kyre+ g++ OB01G45050.1 19 VREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTINGEDLLYAMGTLGFEEYVEPLRIYLQKYREVMGDS 115 69*******************************************************************************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.8E-53 | 17 | 127 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.26E-39 | 22 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.1E-28 | 25 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.0E-22 | 53 | 71 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 56 | 72 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.0E-22 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 2.0E-22 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MADGGSHDES GSPPRSGGVR EQDRFLPIAN ISRIMKKAVP ANGKIAKDAK ETLQECVSEF 60 ISFVTSEASD KCQKEKRKTI NGEDLLYAMG TLGFEEYVEP LRIYLQKYRE VMGDSKLTSK 120 ADGSVKKDAI GPQSGASSSS AQGMVGAYTQ GMGYMQPQNN FHTLAVFQSF AFRYMYHFTQ 180 IYCKYPSFE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 3e-48 | 20 | 110 | 3 | 93 | NF-YB |
4awl_B | 3e-48 | 20 | 110 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-48 | 20 | 110 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB01G45050.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY332466 | 0.0 | AY332466.1 Oryza sativa (japonica cultivar-group) CCAAT-binding protein (CCB1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006644967.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-2 | ||||
Swissprot | Q5QMG3 | 1e-95 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | J3L5J9 | 1e-139 | J3L5J9_ORYBR; Uncharacterized protein | ||||
STRING | OB01G45050.1 | 1e-140 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 6e-63 | nuclear factor Y, subunit B8 |