PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART11G01660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ZF-HD
Protein Properties Length: 106aa    MW: 10917 Da    PI: 8.2955
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART11G01660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.47.1e-333288259
      ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                     + vrY+eC++NhAas+GghavDGC+Efm+s g++gtaaal CaACgCHR+FHRreve 
  OBART11G01660.1 32 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GADGTAAALLCAACGCHRSFHRREVEA 88
                     579**************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-1232100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-313486IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-273586IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.5923685IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MGPQQDRSAA KPYANGSTAA AAAAAGRKEN NKVVRYRECQ RNHAASIGGH AVDGCREFMA  60
SGADGTAAAL LCAACGCHRS FHRREVEAAA AECDCSSDTS SGTGRR
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8337331e-177CT833733.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA035B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615851.12e-56mini zinc finger protein 1
RefseqXP_015620648.12e-56mini zinc finger protein 2
SwissprotB8BIU82e-57MIF1_ORYSI; Mini zinc finger protein 1
SwissprotB8BLT32e-57MIF2_ORYSI; Mini zinc finger protein 2
SwissprotB9GBM32e-57MIF2_ORYSJ; Mini zinc finger protein 2
SwissprotQ2RB282e-57MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBLA0A0D3HHP05e-69A0A0D3HHP0_9ORYZ; Uncharacterized protein
TrEMBLI1R3L45e-69I1R3L4_ORYGL; Uncharacterized protein
STRINGORGLA12G0012000.18e-70(Oryza glaberrima)
STRINGOBART11G01660.18e-70(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-19mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]