PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART11G01660.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 106aa MW: 10917 Da PI: 8.2955 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.4 | 7.1e-33 | 32 | 88 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + vrY+eC++NhAas+GghavDGC+Efm+s g++gtaaal CaACgCHR+FHRreve OBART11G01660.1 32 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GADGTAAALLCAACGCHRSFHRREVEA 88 579**************************9.999*********************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-12 | 32 | 100 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 4.1E-31 | 34 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 2.6E-27 | 35 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.592 | 36 | 85 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MGPQQDRSAA KPYANGSTAA AAAAAGRKEN NKVVRYRECQ RNHAASIGGH AVDGCREFMA 60 SGADGTAAAL LCAACGCHRS FHRREVEAAA AECDCSSDTS SGTGRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT833733 | 1e-177 | CT833733.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA035B08, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015615851.1 | 2e-56 | mini zinc finger protein 1 | ||||
Refseq | XP_015620648.1 | 2e-56 | mini zinc finger protein 2 | ||||
Swissprot | B8BIU8 | 2e-57 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
Swissprot | B8BLT3 | 2e-57 | MIF2_ORYSI; Mini zinc finger protein 2 | ||||
Swissprot | B9GBM3 | 2e-57 | MIF2_ORYSJ; Mini zinc finger protein 2 | ||||
Swissprot | Q2RB28 | 2e-57 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
TrEMBL | A0A0D3HHP0 | 5e-69 | A0A0D3HHP0_9ORYZ; Uncharacterized protein | ||||
TrEMBL | I1R3L4 | 5e-69 | I1R3L4_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA12G0012000.1 | 8e-70 | (Oryza glaberrima) | ||||
STRING | OBART11G01660.1 | 8e-70 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1431 | 34 | 120 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 3e-19 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|