PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART10G09030.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 180aa MW: 20077.7 Da PI: 10.1297 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 75.5 | 1.1e-23 | 67 | 123 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 dep+YVNaKQy++I++RRq+R+ + +e+k+ ++ rk++l e+R+k+A+ R+Rg+gGrF OBART10G09030.1 67 DEPIYVNAKQYHAIIRRRQRRKIVGSEDKV-AAIRKRILVEARQKQAKLRRRGKGGRF 123 79****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.4E-17 | 65 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 22.337 | 66 | 126 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.1E-16 | 68 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.8E-13 | 69 | 91 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.8E-13 | 100 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MGFGESTQGN QRKLDGPGKV STELSLVNLE AKNLHPKPEC NQPLEHIPTK GMKCTPLLPL 60 PTEHADDEPI YVNAKQYHAI IRRRQRRKIV GSEDKVAAIR KRILVEARQK QAKLRRRGKG 120 GRFISIEHPL ELSMDDQISK NGGSASPSSS TVSENSSNVN GFTEYDQENN HITRSITIQS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-13 | 67 | 125 | 2 | 60 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU847005 | 0.0 | EU847005.1 Oryza sativa Japonica Group clone KCS241E10 CCAAT-binding transcription factor mRNA, complete cds. | |||
GenBank | HQ731478 | 0.0 | HQ731478.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y21) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015613426.1 | 1e-116 | nuclear transcription factor Y subunit A-3 | ||||
TrEMBL | A0A0D3HDC6 | 1e-130 | A0A0D3HDC6_9ORYZ; Uncharacterized protein | ||||
STRING | OBART10G09030.1 | 1e-131 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP17468 | 10 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G72830.1 | 1e-17 | nuclear factor Y, subunit A3 |