PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART05G18190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 354aa    MW: 39716.1 Da    PI: 9.0536
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART05G18190.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding262.1e-082773347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +W++ Ed+ +  a   ++ +   +W+++a++++ gR++ ++ +++q +
  OBART05G18190.1 27 PWSKAEDKVFESALVTFPEHthnRWALVASRLP-GRSAHEVWEHYQVL 73
                     8*****************99*************.************76 PP

2Myb_DNA-binding43.86e-14114158347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
  OBART05G18190.1 114 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKF 158
                      8******************************************98 PP

3Myb_DNA-binding24.27.6e-08198244347
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 
                      +W++ Ed+ +  a   ++ +   +W+++a++++ gR++ ++ ++++ +
  OBART05G18190.1 198 PWSKAEDKVFESALVAFPEHthnRWALVASRLP-GRSAHEVWEHYRVL 244
                      8**************99999999**********.***********975 PP

4Myb_DNA-binding43.86e-14286330347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qk+
  OBART05G18190.1 286 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKF 330
                      8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.0532078IPR017930Myb domain
SMARTSM007171.6E-72476IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-112681IPR009057Homeodomain-like
PfamPF002494.3E-72773IPR001005SANT/Myb domain
CDDcd001679.23E-62774No hitNo description
Gene3DG3DSA:1.10.10.601.5E-62771IPR009057Homeodomain-like
PROSITE profilePS5129419.617107163IPR017930Myb domain
SuperFamilySSF466891.72E-17109163IPR009057Homeodomain-like
SMARTSM007172.8E-10111161IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.1E-16111162IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.9E-11113154IPR009057Homeodomain-like
PfamPF002492.4E-10114157IPR001005SANT/Myb domain
CDDcd001675.08E-10114159No hitNo description
SMARTSM007171.5E-7195247IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-11197252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-6197242IPR009057Homeodomain-like
PROSITE profilePS500906.934198245IPR017877Myb-like domain
PfamPF002491.3E-6198244IPR001005SANT/Myb domain
CDDcd001674.19E-6198245No hitNo description
PROSITE profilePS5129419.617279335IPR017930Myb domain
SuperFamilySSF466891.66E-17281335IPR009057Homeodomain-like
SMARTSM007172.8E-10283333IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.1E-16283334IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.9E-11285326IPR009057Homeodomain-like
PfamPF002492.4E-10286329IPR001005SANT/Myb domain
CDDcd001675.08E-10286331No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAFYLGSMGG SPSSWGVAEV PVPSSRPWSK AEDKVFESAL VTFPEHTHNR WALVASRLPG  60
RSAHEVWEHY QVLVDDVDLI ERGMVASPGC WDDDNNSAGH GRGSGGDERR RGVPWTEEEH  120
RLFLEGLEKY GRGDWRNISR WSVKTRTPTQ VASHAQKFFI RQANASSRGD SKRMAFYGGE  180
MGGSSSSWVA PLVPSSRPWS KAEDKVFESA LVAFPEHTHN RWALVASRLP GRSAHEVWEH  240
YRVLVDDVDL IERGMVASPG CWDDGASRGG AQGASRSGDE RRRGVPWTEE EHRLFLEGLE  300
KYGRGDWRNI SRWSVKTRTP TQVASHAQKF FIRQANAGNR SDSKRKSIHD IIAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-132489772RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071340.0AK107134.1 Oryza sativa Japonica Group cDNA clone:002-124-C08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638220.11e-122transcription factor DIVARICATA
SwissprotQ8S9H72e-46DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3G8770.0A0A0D3G877_9ORYZ; Uncharacterized protein
STRINGOBART05G18190.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-43MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]