PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OBART05G16940.1

Organism

Oryza barthii

Taxonomic ID

65489

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

NAC

Protein Properties

Length: 137aa MW: 15325.6 Da PI: 10.704

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OBART05G16940.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	31.1	7e-10	18	40	1	23
NAM 1 lppGfrFhPtdeelvveyLkkkv 23 lppGfrFhPtdeelv++yL+++ OBART05G16940.1 18 LPPGFRFHPTDEELVMHYLCRRN 40 79*****************9986 PP
2	NAM	38.8	2.7e-12	84	116	96	128
NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +kk Lvfy g+apkg kt+W+mheyrl OBART05G16940.1 84 RQQPGPIKKALVFYAGKAPKGDKTNWIMHEYRL 116 5666779************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.66E-21	13	120	IPR003441	NAC domain
PROSITE profile	PS51005	9.532	18	137	IPR003441	NAC domain
Pfam	PF02365	1.6E-14	19	116	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MSGGGEGAAA AEKQELQLPP GFRFHPTDEE LVMHYLCRRN GAVRREGVVL LLPSGPQVPE 60 RVAAEPRRRV RVLEGDGARQ AHPRQQPGPI KKALVFYAGK APKGDKTNWI MHEYRLADVD 120 RSARKKNTLR VHIYAIN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-21	15	116	12	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269\|PubMed:17587305, ECO:0000269\|PubMed:18273684, ECO:0000269\|PubMed:19453457, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269\|PubMed:11332734, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC124836	1e-128	AC124836.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0092E21, complete sequence.
GenBank	AP014961	1e-128	AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBank	CP012613	1e-128	CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015692607.1	8e-37	PREDICTED: NAC domain-containing protein 48-like
Refseq	XP_025810017.1	1e-36	NAC domain-containing protein 48-like
Swissprot	Q7F2L3	2e-35	NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBL	A0A0D3G7S6	1e-95	A0A0D3G7S6_9ORYZ; Uncharacterized protein
STRING	OBART05G16940.1	2e-96	(Oryza barthii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	2e-31	NAC family protein

Publications ? help Back to Top
Xiong L,Lee MW,Qi M,Yang Y Identification of defense-related rice genes by suppression subtractive hybridization and differential screening. Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92 [PMID:11332734] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ohnishi T, et al. OsNAC6, a member of the NAC gene family, is induced by various stresses in rice. Genes Genet. Syst., 2005. 80(2): p. 135-9 [PMID:16172526] Hu H, et al. Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice. Plant Mol. Biol., 2008. 67(1-2): p. 169-81 [PMID:18273684] Kim MJ, et al. Quadruple 9-mer-based protein binding microarray with DsRed fusion protein. BMC Mol. Biol., 2009. 10: p. 91 [PMID:19761621] Chung PJ,Kim JK Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth. Plant Signal Behav, 2009. 4(7): p. 675-7 [PMID:19820307] Peng HF, et al. Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.). Theor. Appl. Genet., 2010. 120(5): p. 1013-20 [PMID:20012261] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Kim MJ, et al. Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein. Methods Mol. Biol., 2012. 786: p. 65-77 [PMID:21938620] Gupta SK, et al. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice. J. Exp. Bot., 2012. 63(2): p. 757-72 [PMID:22058403] Nakashima K, et al. Comparative functional analysis of six drought-responsive promoters in transgenic rice. Planta, 2014. 239(1): p. 47-60 [PMID:24062085] Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice. Rice (N Y), 2012. 5(1): p. 6 [PMID:24764506] Qian B, et al. Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+). J. Plant Physiol., 2015. 175: p. 9-20 [PMID:25460871] Shiriga K, et al. Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize. Meta Gene, 2014. 2: p. 407-17 [PMID:25606426] Farooq MA,Detterbeck A,Clemens S,Dietz KJ Silicon-induced reversibility of cadmium toxicity in rice. J. Exp. Bot., 2016. 67(11): p. 3573-85 [PMID:27122572] Lee DK, et al. The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance. Plant Biotechnol. J., 2017. 15(6): p. 754-764 [PMID:27892643]