PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART05G16940.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 137aa MW: 15325.6 Da PI: 10.704 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 31.1 | 7e-10 | 18 | 40 | 1 | 23 |
NAM 1 lppGfrFhPtdeelvveyLkkkv 23 lppGfrFhPtdeelv++yL+++ OBART05G16940.1 18 LPPGFRFHPTDEELVMHYLCRRN 40 79*****************9986 PP | |||||||
2 | NAM | 38.8 | 2.7e-12 | 84 | 116 | 96 | 128 |
NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++ +kk Lvfy g+apkg kt+W+mheyrl OBART05G16940.1 84 RQQPGPIKKALVFYAGKAPKGDKTNWIMHEYRL 116 5666779************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.66E-21 | 13 | 120 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 9.532 | 18 | 137 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-14 | 19 | 116 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MSGGGEGAAA AEKQELQLPP GFRFHPTDEE LVMHYLCRRN GAVRREGVVL LLPSGPQVPE 60 RVAAEPRRRV RVLEGDGARQ AHPRQQPGPI KKALVFYAGK APKGDKTNWI MHEYRLADVD 120 RSARKKNTLR VHIYAIN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-21 | 15 | 116 | 12 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269|PubMed:17587305, ECO:0000269|PubMed:18273684, ECO:0000269|PubMed:19453457, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269|PubMed:11332734, ECO:0000269|PubMed:20632034, ECO:0000269|PubMed:27892643}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC124836 | 1e-128 | AC124836.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0092E21, complete sequence. | |||
GenBank | AP014961 | 1e-128 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012613 | 1e-128 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015692607.1 | 8e-37 | PREDICTED: NAC domain-containing protein 48-like | ||||
Refseq | XP_025810017.1 | 1e-36 | NAC domain-containing protein 48-like | ||||
Swissprot | Q7F2L3 | 2e-35 | NAC48_ORYSJ; NAC domain-containing protein 48 | ||||
TrEMBL | A0A0D3G7S6 | 1e-95 | A0A0D3G7S6_9ORYZ; Uncharacterized protein | ||||
STRING | OBART05G16940.1 | 2e-96 | (Oryza barthii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01720.1 | 2e-31 | NAC family protein |