PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART04G30090.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 125aa MW: 13251.1 Da PI: 9.1825 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 83.9 | 1.9e-26 | 54 | 116 | 37 | 99 |
NF-YC 37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 +mis eaPv++skacelfi elt r+w + e krrt++k d+aaav++td fdflvd+v d OBART04G30090.1 54 RMISGEAPVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTAD 116 8**********************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 2.27E-24 | 18 | 109 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 8.3E-31 | 19 | 101 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.0E-12 | 52 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MRQARPYSAM FAGGVSARTG PHALPLARIK KIMKRSAGDS SVVDGGGGGG GGTRMISGEA 60 PVVFSKACEL FIAELTRRAW AATLEGKRRT VHKEDVAAAV QNTDLFDFLV DVVTADLGDD 120 HTDYK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 7e-31 | 22 | 113 | 16 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB288047 | 0.0 | AB288047.1 Oryza sativa Japonica Group OsHAP5G gene for HAP5 subunit of HAP complex, complete cds. | |||
GenBank | AL606641 | 0.0 | AL606641.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0032F06, complete sequence. | |||
GenBank | AP014960 | 0.0 | AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015635297.1 | 3e-86 | nuclear transcription factor Y subunit C-2 | ||||
Swissprot | Q8LCG7 | 5e-30 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
Swissprot | Q9ZVL3 | 8e-30 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
TrEMBL | A0A0D3G1W1 | 1e-85 | A0A0D3G1W1_9ORYZ; Uncharacterized protein | ||||
TrEMBL | I1PR20 | 1e-85 | I1PR20_ORYGL; Uncharacterized protein | ||||
STRING | ORGLA04G0263900.1 | 2e-86 | (Oryza glaberrima) | ||||
STRING | OBART04G30090.1 | 2e-86 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11658 | 33 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56170.2 | 7e-31 | nuclear factor Y, subunit C2 |