PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART04G19730.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 164aa MW: 18581 Da PI: 10.3889 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.4 | 2.1e-15 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l d + ++G g+W++++ + g+ R +k+c++rw +yl OBART04G19730.1 15 KGLWSPEEDQKLRDFILRYGHGCWSAVPVKAGLQRNGKSCRLRWINYL 62 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.8 | 1.9e-16 | 69 | 113 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g ++ eE+e ++++ +G++ W+ Iar+++ gRt++++k++w++yl OBART04G19730.1 69 GMFSREEEETVMNLHATMGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113 56999****************.*********.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.3E-21 | 10 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 13.9 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.6E-29 | 13 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.9E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-13 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.23E-9 | 18 | 62 | No hit | No description |
PROSITE profile | PS51294 | 24.273 | 63 | 117 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-26 | 66 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.1E-14 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.9E-15 | 69 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.11E-11 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0010018 | Biological Process | far-red light signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MGCKACQKPK VHYRKGLWSP EEDQKLRDFI LRYGHGCWSA VPVKAGLQRN GKSCRLRWIN 60 YLRPGLKHGM FSREEEETVM NLHATMGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGA 120 EAAARKSAEP ADVVTGSPNR SETGQERVAA DRPASSESSG RTRP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 15 | 118 | 7 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK107135 | 0.0 | AK107135.1 Oryza sativa Japonica Group cDNA clone:002-124-C09, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015636234.1 | 1e-116 | transcription factor LAF1 | ||||
Swissprot | Q9M0K4 | 2e-58 | LAF1_ARATH; Transcription factor LAF1 | ||||
TrEMBL | A0A0D3FYB0 | 1e-119 | A0A0D3FYB0_9ORYZ; Uncharacterized protein | ||||
STRING | OBART04G19730.1 | 1e-120 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1707 | 37 | 109 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G25560.1 | 3e-60 | myb domain protein 18 |
Publications ? help Back to Top | |||
---|---|---|---|
|