PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OBART04G13830.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 152aa MW: 17835.2 Da PI: 10.0052 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 173 | 8.9e-54 | 10 | 139 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 +ppGfrFhPtdeel+ +yLkkkv +k++l evi+evd++k+ePwdL++ ++ + ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk OBART04G13830.1 10 VPPGFRFHPTDEELLLYYLKKKVGFEKFDL-EVIREVDLNKIEPWDLQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRATTAGFWKATGRDKC 102 69****************************.99**************963433332566*********************************** PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 + + + +++g++ktLvfy+grap+g+ktdW+mheyrle OBART04G13830.1 103 IRT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 139 **9.8999****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.75E-56 | 5 | 145 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.247 | 10 | 152 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-28 | 11 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048829 | Biological Process | root cap development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 152 aa Download sequence Send to blast |
MAAFSSSNGV PPGFRFHPTD EELLLYYLKK KVGFEKFDLE VIREVDLNKI EPWDLQERCR 60 IGSAPQNEWY FFSHKDRKYP TGSRTNRATT AGFWKATGRD KCIRTSYRKI GMRKTLVFYR 120 GRAPHGQKTD WIMHEYRLED ADDSQSASSK NK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 1e-49 | 10 | 138 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00431 | DAP | Transfer from AT4G10350 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU971542 | 0.0 | EU971542.1 Zea mays clone 366845 NAC domain-containing protein 76 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015635180.1 | 1e-109 | protein BEARSKIN2-like | ||||
Swissprot | Q9SV87 | 3e-94 | BRN2_ARATH; Protein BEARSKIN2 | ||||
TrEMBL | A0A0D3FW98 | 1e-111 | A0A0D3FW98_9ORYZ; Uncharacterized protein | ||||
TrEMBL | B8BJN1 | 1e-107 | B8BJN1_ORYSI; Uncharacterized protein | ||||
STRING | OBART04G13830.1 | 1e-112 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP9297 | 30 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G10350.1 | 3e-89 | NAC domain containing protein 70 |
Publications ? help Back to Top | |||
---|---|---|---|
|