PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OBART04G08050.1

Organism

Oryza barthii

Taxonomic ID

65489

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MYB_related

Protein Properties

Length: 136aa MW: 15098.9 Da PI: 11.8538

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OBART04G08050.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	25.1	4.2e-08	44	86	5	47
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T+eE+ l++ + ++G+g+ +I+r + Rt+ q+ s+ qky OBART04G08050.1 44 TEEEHRLFLLGLDKFGKGDLQSISRNFVISRTPTQVASHAQKY 86 9*************************99**********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	9.386	35	91	IPR017930	Myb domain
SuperFamily	SSF46689	3.49E-13	38	92	IPR009057	Homeodomain-like
SMART	SM00717	9.0E-4	39	89	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-6	44	86	IPR001005	SANT/Myb domain
CDD	cd00167	3.19E-6	44	87	No hit	No description
TIGRFAMs	TIGR01557	1.5E-13	44	89	IPR006447	Myb domain, plants
Gene3D	G3DSA:1.10.10.60	1.5E-5	44	85	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MSSRAPAPGG TSRRRRKADE GHRYDGGKSC SKAEQERRKG IPSTEEEHRL FLLGLDKFGK 60 GDLQSISRNF VISRTPTQVA SHAQKYFIRL NSMNRDRRRS SIHDITSVTA GDVAAQQGPI 120 TGQAKAALRR RSGHRA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269\|PubMed:12172034, ECO:0000269\|PubMed:22773748}.
UniProt	Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250\|UniProtKB:Q8LH59}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269\|PubMed:12172034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AL606729	1e-143	AL606729.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0062B06, complete sequence.
GenBank	AP014960	1e-143	AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBank	CR855227	1e-143	CR855227.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0159H11-OSIGBa0137A07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003565794.1	7e-63	transcription factor MYBS1
Swissprot	B8A9B2	1e-57	MYBS1_ORYSI; Transcription factor MYBS1
Swissprot	Q8LH59	1e-57	MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBL	A0A0D3FUD0	5e-94	A0A0D3FUD0_9ORYZ; Uncharacterized protein
STRING	OBART04G08050.1	8e-95	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP9466	30	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G08520.1	2e-39	MYB family protein

Publications ? help Back to Top
Hong YF, et al. Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748]