PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009626749.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 94aa MW: 11172.9 Da PI: 10.1953 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.7 | 1.8e-15 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l+ ++ ++G +W+ ++ g+ Rt+k+c++rw +yl XP_009626749.1 20 KGAWSPEEDQKLKTYIMRYGIWNWSHMPKFAGLSRTGKSCRLRWVNYL 67 79******************99************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 20.285 | 15 | 71 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 15 | 69 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.4E-12 | 19 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.4E-14 | 20 | 67 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.62E-21 | 21 | 94 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.82E-10 | 22 | 67 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-5 | 70 | 94 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MPRLPPQQQQ KSTNMEEIKK GAWSPEEDQK LKTYIMRYGI WNWSHMPKFA GLSRTGKSCR 60 LRWVNYLSPD VKRGPFIMEE VEIVVKTYQE LGNR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-15 | 17 | 94 | 24 | 100 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 2e-38 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
GenBank | HG975515 | 2e-38 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009594711.1 | 4e-65 | PREDICTED: trichome differentiation protein GL1-like isoform X3 | ||||
Refseq | XP_009626749.1 | 2e-65 | PREDICTED: transcription factor MYB86-like | ||||
Swissprot | Q8LPH6 | 2e-27 | MYB86_ARATH; Transcription factor MYB86 | ||||
TrEMBL | A0A1S3Y1D6 | 1e-63 | A0A1S3Y1D6_TOBAC; trichome differentiation protein GL1-like | ||||
STRING | XP_009594711.1 | 2e-64 | (Nicotiana tomentosiformis) | ||||
STRING | XP_009626749.1 | 7e-65 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26660.1 | 9e-30 | myb domain protein 86 |