PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625507.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family STAT
Protein Properties Length: 692aa    MW: 78103.4 Da    PI: 5.5391
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625507.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT189.73.4e-592063251120
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldv+l++++++p++ +vevva L+yad+ ++vek+ d+eapLL++ydG+e++s+drp+k++ GrasfklkisqLsskcdnrLf+i+feipk+ +y
  XP_009625507.1 206 LDVTLMDSFSRPITEEVEVVALLVYADDEAPVEKPVDDEAPLLTNYDGIEYASSDRPSKVISGRASFKLKISQLSSKCDNRLFCIRFEIPKMGNY 300
                     89********************************************************************************************* PP

            STAT  96 pfleavskpirCisrsrntrssslt 120
                     pfle++s+pirCisr+rntr++sl+
  XP_009625507.1 301 PFLEVFSRPIRCISRNRNTRAASLM 325
                     ********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498992.85E-820126IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2006.3E-573133IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.102.5E-7595652IPR000980SH2 domain
SuperFamilySSF555504.13E-10596656IPR000980SH2 domain
PROSITE profilePS5000110.39598676IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MGIQDYGFLE DLQVEFKDYD GTNGFFLCFW FYLNKASTLP STILLQKHPV ATSHAPFLLL  60
DEKKRLLLYP LLTSWREDAY ATSESEFPMK KWVHVGCEVT KDLLRLYLDG EIVGEKSLTS  120
SLNNDSVSDS SEISLPCISG KGSQLDGYVY SAELLPVVSS IKNHYVKDPP VQLSIDSSSA  180
YEIEEDTDGV WSIVGGKASC RRNFSLDVTL MDSFSRPITE EVEVVALLVY ADDEAPVEKP  240
VDDEAPLLTN YDGIEYASSD RPSKVISGRA SFKLKISQLS SKCDNRLFCI RFEIPKMGNY  300
PFLEVFSRPI RCISRNRNTR AASLMLRKSS LGIHLLNGSQ SPILEDGSSD LPSIVREAKQ  360
SLSSKRVKLG QEKLCANFKD DFVLQQANGE SKSHSWISED NYAYHNSLVA RPVSRGRAEN  420
FSSDSENSET TNSVIDDLPS NRDPISDVDV FKYCLGDLNE RRLLLKEMAV TAKEEELATF  480
AERVSLFSGC SHHRHQISIS KRLIEEGIKC WNLISDDNHH VPWMNLVSGL QEHFLKMTFG  540
RTRSLTHQDF DLLRRVSSCQ DLVSQDNFEK LWCWLYPVAF TLSQQCITSL WGSASPVWIE  600
GFITKEEAES SLRGQGPGTF ILRFPTSRSW PHPDAGNLVA TYVGSDYTIH HRLVSLDFIY  660
SFGSKGMTIK PIQDMLLEQP ELRRLGRIVR SQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103541e-127AC210354.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0102J11, complete sequence.
GenBankHG9755191e-127HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625507.10.0PREDICTED: uncharacterized protein LOC104116371 isoform X2
TrEMBLA0A1S3YFP30.0A0A1S3YFP3_TOBAC; uncharacterized protein LOC107775818 isoform X2
STRINGXP_009625506.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B