PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009617435.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 202aa MW: 23779.7 Da PI: 9.5844 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 30.1 | 1.1e-09 | 9 | 52 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 WT Ed+l+ +a +++ g +W +Ia +++ g++++++ ++ XP_009617435.1 9 TWTRYEDKLFEEALVMYPEGvvnRWQKIAIHVP-GKSPEDVMAHY 52 7********************************.********998 PP | |||||||
2 | Myb_DNA-binding | 44 | 5.1e-14 | 112 | 156 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r + +Rt+ q+ s+ qky XP_009617435.1 112 PWTPEEHRLFLIGLERYGKGDWRSISRNVVVTRTPMQVASHAQKY 156 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 8.7 | 5 | 59 | IPR017884 | SANT domain |
SMART | SM00717 | 2.5E-8 | 6 | 58 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.2E-9 | 8 | 52 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.84E-12 | 8 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.04E-8 | 9 | 52 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.5E-5 | 9 | 56 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.666 | 105 | 161 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.08E-17 | 105 | 162 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.3E-16 | 108 | 160 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.1E-12 | 109 | 159 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-12 | 109 | 158 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.1E-12 | 112 | 156 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.04E-9 | 112 | 157 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MYMIHSTSTW TRYEDKLFEE ALVMYPEGVV NRWQKIAIHV PGKSPEDVMA HYDALVHDVF 60 VIDSGRVDIP SYNHRSSEWE PESGTRTRTS HNISFESNYK NHAEQIRKKG TPWTPEEHRL 120 FLIGLERYGK GDWRSISRNV VVTRTPMQVA SHAQKYFKRQ ESMKKKERKR SSIHDITVDT 180 NILLPQNNNQ NQGVYQNYNF PL |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 157 | 169 | KRQESMKKKERKR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009617435.1 | 1e-151 | PREDICTED: transcription factor DIVARICATA-like | ||||
Refseq | XP_016510464.1 | 1e-151 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 1e-50 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
Swissprot | Q9FNN6 | 1e-50 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A1S4DB83 | 1e-150 | A0A1S4DB83_TOBAC; transcription factor DIVARICATA-like | ||||
STRING | XP_009617435.1 | 1e-151 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4547 | 22 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 3e-59 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|