PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009605381.1 | ||||||||
Common Name | An2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 220aa MW: 25443 Da PI: 9.9243 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 53.6 | 5.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd ll+++++++G g W+ ++ + g++R++k+c++rw++yl XP_009605381.1 14 KGAWTEEEDVLLKKCIEKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 46.8 | 6.7e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++ +E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l XP_009605381.1 67 RGDFSFDEVDLILRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNSHL 112 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-23 | 9 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.149 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.26E-29 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.9E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.92E-11 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.3E-23 | 65 | 117 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.643 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 4.8E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-13 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-9 | 70 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0031540 | Biological Process | regulation of anthocyanin biosynthetic process | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 220 aa Download sequence Send to blast |
MNICTNKSSS GVKKGAWTEE EDVLLKKCIE KYGEGKWHQV PLRAGLNRCR KSCRLRWLNY 60 LRPHIKRGDF SFDEVDLILR LHKLLGNRWS LIAGRLPGRT ANDVKNYWNS HLRKKLIAPH 120 DQKESKQKAK KITIFRPRPR TFSKTNTCVK SNTNTVDKDI EGSSEIIRFN DNLKPTTEEL 180 TDDGIQWWAD LLANNYNNNG IEEADNSSPT LLHEEMPLLS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-23 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00213 | DAP | Transfer from AT1G66370 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ472647 | 1e-143 | FJ472647.1 Nicotiana tabacum cultivar SamsunNN anthocyanin 2 (An2) mRNA, complete cds. | |||
GenBank | FJ472648 | 1e-143 | FJ472648.1 Nicotiana tomentosiformis anthocyanin 2 (An2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001306786.1 | 1e-163 | transcription factor MYB114-like | ||||
Refseq | NP_001312447.1 | 1e-163 | transcription factor MYB114-like | ||||
Swissprot | Q9FNV9 | 2e-68 | MY113_ARATH; Transcription factor MYB113 | ||||
TrEMBL | C1JAC9 | 1e-161 | C1JAC9_TOBAC; Anthocyanin 2 | ||||
TrEMBL | C1JAD0 | 1e-161 | C1JAD0_NICTO; Anthocyanin 2 | ||||
STRING | XP_009605381.1 | 1e-162 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66370.1 | 7e-71 | myb domain protein 113 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 104099949 |
Publications ? help Back to Top | |||
---|---|---|---|
|