PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009599310.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 105aa MW: 11887.3 Da PI: 9.3369 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 24.1 | 6.2e-08 | 48 | 88 | 3 | 43 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterq 43 k+ t+ + +++L e F++n+yp++++ e+L k+lgLt q XP_009599310.1 48 KKKTYREGAIKRLYESFKENQYPDRDANEKLGKELGLTAHQ 88 567888999****************************9766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.99E-5 | 46 | 88 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 2.2E-5 | 48 | 88 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 2.9E-7 | 48 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.65E-5 | 48 | 88 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MTSPSSTLAD TKYQSGKQKG SRHASDRGLC EKLKIGGMDT SELHSSGKKK TYREGAIKRL 60 YESFKENQYP DRDANEKLGK ELGLTAHQRQ FDQEGYVVLI QVIYE |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009599310.1 | 1e-72 | PREDICTED: pathogenesis-related homeodomain protein-like isoform X1 | ||||
Refseq | XP_009599311.1 | 1e-72 | PREDICTED: pathogenesis-related homeodomain protein-like isoform X1 | ||||
TrEMBL | A0A1S3Z5D4 | 1e-70 | A0A1S3Z5D4_TOBAC; pathogenesis-related homeodomain protein-like isoform X2 | ||||
STRING | XP_009599310.1 | 4e-72 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G19510.1 | 4e-06 | Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain |