PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009596465.1

Organism

Nicotiana tomentosiformis

Taxonomic ID

4098

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

ZF-HD

Protein Properties

Length: 92aa MW: 10205.4 Da PI: 5.6097

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009596465.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	105.3	3.7e-33	27	83	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY+eC+kNhAas+Gg+avDGC+Efmp geegt+ +l+CaACgCHRnFHRreve+e XP_009596465.1 27 TVRYRECQKNHAASVGGYAVDGCREFMPC-GEEGTPGGLTCAACGCHRNFHRREVETE 83 79************************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-26	1	91	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.1E-30	28	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.3E-28	29	80	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.731	30	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MTKRQVILMK DDFSDDDSTN SSFTIRTVRY RECQKNHAAS VGGYAVDGCR EFMPCGEEGT 60 PGGLTCAACG CHRNFHRREV ETEVACDCSF PT

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009596464.1	8e-64	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_009596465.1	8e-64	PREDICTED: mini zinc finger protein 2-like
Refseq	XP_009596466.1	8e-64	PREDICTED: mini zinc finger protein 2-like
Swissprot	Q9LJW5	3e-36	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A1S3YLG5	2e-61	A0A1S3YLG5_TOBAC; mini zinc finger protein 2-like
STRING	XP_009596464.1	3e-63	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	3e-36	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]