PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009594709.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 178aa MW: 20612.6 Da PI: 9.8577 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.8 | 3e-14 | 38 | 83 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + eE e+ v+ ++lG++ W+tIa++++ gRt++++k++++++l XP_009594709.1 38 RGPLSMEEVEIVVKMYQELGNR-WSTIAARLP-GRTDNEVKNFFHTHL 83 788899****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 6.388 | 1 | 32 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-10 | 2 | 39 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.09E-20 | 18 | 88 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.357 | 33 | 87 | IPR017930 | Myb domain |
SMART | SM00717 | 4.1E-12 | 37 | 85 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-11 | 38 | 83 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.9E-22 | 40 | 87 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.49E-9 | 44 | 83 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MKYGIWNWSQ MPIFAGLSRT GKSCRLRWVN YLCPDVKRGP LSMEEVEIVV KMYQELGNRW 60 STIAARLPGR TDNEVKNFFH THLKKHLGLK NNAPLKIMAR RKRVDQTKEN DKTNTIEAEE 120 RPVLGTTSTS SSWLLSPDVS SPCSSTMTHE ENQMMDVVNF SQTYLNWYNV NVENTVRK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-16 | 1 | 85 | 43 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds DNA to the AC cis-elements 5'-ACCTACC-3', 5'-ACCAACC-3' and 5'-ACCTAAC-3' of promoters and specifically activates lignin biosynthetic genes during secondary wall formation mediated by SND1. {ECO:0000269|PubMed:19122102}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by light (PubMed:9839469). Regulated by the SND1 close homologs NST1, NST2, VND6, and VND7 and their downstream targets MYB46 and MYB83 (PubMed:19122102, PubMed:22197883). {ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975442 | 6e-34 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
GenBank | HG975515 | 6e-34 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018624629.1 | 1e-130 | PREDICTED: transcription factor MYB82-like isoform X4 | ||||
Swissprot | Q9SA47 | 9e-34 | MYB58_ARATH; Transcription factor MYB58 | ||||
TrEMBL | A0A1J6JBL1 | 1e-107 | A0A1J6JBL1_NICAT; Myb-related protein myb4 | ||||
STRING | XP_009594709.1 | 1e-132 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G16490.1 | 5e-36 | myb domain protein 58 |
Publications ? help Back to Top | |||
---|---|---|---|
|