PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009593700.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 201aa MW: 23051.8 Da PI: 8.4465 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 74.3 | 9.5e-24 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gk ye XP_009593700.1 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKRYEL 57 79*******************************************9985 PP | |||||||
2 | K-box | 55.3 | 2.9e-19 | 91 | 174 | 17 | 100 |
K-box 17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + e++ Lk eie Lqr + + G + ++++l eL++Le+ Le + +iRs K+++++++i+ l++ke lq +nk+L+ k+ee XP_009593700.1 91 PKGEINMLKHEIEVLQRGLSYMYGGGAGTMTLDELHSLEKYLELWMFHIRSAKMDIMFQEIQLLKNKEGILQAANKYLQDKIEE 174 56799****************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.4E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.16E-26 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.072 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.04E-37 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 4.3E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.2E-21 | 10 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.3E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.757 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 6.2E-21 | 92 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKRYELATK 60 GTMQGLIEKY LKSTRGAEVA EEAKDIQALD PKGEINMLKH EIEVLQRGLS YMYGGGAGTM 120 TLDELHSLEK YLELWMFHIR SAKMDIMFQE IQLLKNKEGI LQAANKYLQD KIEEQYPVTN 180 MTSTLTDFQC PLTVQNEIFQ F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-15 | 1 | 92 | 1 | 91 | MEF2C |
5f28_B | 1e-15 | 1 | 92 | 1 | 91 | MEF2C |
5f28_C | 1e-15 | 1 | 92 | 1 | 91 | MEF2C |
5f28_D | 1e-15 | 1 | 92 | 1 | 91 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY098737 | 0.0 | AY098737.2 Lycopersicon esculentum TAGL12 transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009593700.1 | 1e-149 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
Refseq | XP_016515329.1 | 1e-149 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 1e-80 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A1S4DQC0 | 1e-148 | A0A1S4DQC0_TOBAC; agamous-like MADS-box protein AGL12 | ||||
STRING | XP_009593700.1 | 1e-148 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9810 | 20 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G71692.1 | 4e-83 | AGAMOUS-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|