PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009593348.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 24922.6 Da PI: 9.2687 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.4 | 7e-18 | 12 | 59 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEd++l+++v+ +G g+W+tI+++ g+ R++k+c++rw +yl XP_009593348.1 12 RGFWKPEEDLILKNCVETHGEGNWATISEKSGLMRSGKSCRLRWKNYL 59 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.8 | 7.7e-16 | 65 | 110 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l XP_009593348.1 65 RGMMSEDEKDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEVKNFWNTHL 110 6789******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.411 | 1 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.97E-29 | 9 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-14 | 11 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.6E-15 | 12 | 59 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.94E-11 | 15 | 59 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.2E-21 | 15 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.788 | 60 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 3.7E-14 | 64 | 112 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-14 | 65 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 67 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.41E-10 | 68 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010026 | Biological Process | trichome differentiation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MKDKEFKTRM KRGFWKPEED LILKNCVETH GEGNWATISE KSGLMRSGKS CRLRWKNYLR 60 PNIKRGMMSE DEKDLIIRLH KLLGNRWSLI AGRLPGRTDN EVKNFWNTHL NKRSCRGKKK 120 HVKSKEANNR SPLGKESQEF PAETVSNKEV AANSVLDSWI EEMQDFNCSL LSPLSMNNVP 180 FLEDEPFIPI LDDIVLLEAF TSTGKEAWNE IQPFL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-22 | 12 | 113 | 7 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF122054 | 0.0 | AF122054.1 Solanum tuberosum clone 9 tuber-specific and sucrose-responsive element binding factor (TSF) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009593348.1 | 1e-158 | PREDICTED: transcription factor MYB82 | ||||
Refseq | XP_016450413.1 | 1e-158 | PREDICTED: transcription factor MYB82-like | ||||
Swissprot | Q9LTF7 | 2e-60 | MYB82_ARATH; Transcription factor MYB82 | ||||
TrEMBL | A0A1S3YEI5 | 1e-156 | A0A1S3YEI5_TOBAC; transcription factor MYB82-like | ||||
STRING | XP_009593348.1 | 1e-157 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G52600.1 | 7e-63 | myb domain protein 82 |