PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016516169.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 106aa MW: 12503.7 Da PI: 10.3052 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.9 | 3e-15 | 8 | 53 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l XP_016516169.1 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 37.6 | 5.2e-12 | 60 | 103 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEde+l+++ k++++ W+tIa +g Rt+ qc +r+ k+l XP_016516169.1 60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERYEKLL 103 68*****************99.********8..**********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.008 | 2 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.14E-12 | 5 | 55 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.2E-19 | 5 | 56 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.0E-15 | 6 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF13921 | 1.0E-14 | 10 | 70 | No hit | No description |
CDD | cd00167 | 3.40E-11 | 10 | 53 | No hit | No description |
SuperFamily | SSF46689 | 4.03E-21 | 39 | 104 | IPR009057 | Homeodomain-like |
CDD | cd11659 | 1.73E-31 | 55 | 106 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.5E-16 | 57 | 104 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.651 | 58 | 106 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-12 | 58 | 105 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT 60 EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERYE KLLDAA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
5xjc_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
5yzg_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
5z56_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
5z57_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
5z58_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
6ff4_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
6ff7_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
6icz_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
6id0_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
6id1_L | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
6qdv_O | 3e-61 | 2 | 106 | 3 | 107 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT013850 | 1e-122 | BT013850.1 Lycopersicon esculentum clone 132810F, mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016516169.1 | 1e-72 | PREDICTED: cell division cycle 5-like protein, partial | ||||
Refseq | XP_019232628.1 | 6e-72 | PREDICTED: cell division cycle 5-like protein | ||||
Swissprot | P92948 | 1e-69 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A067DSG9 | 2e-70 | A0A067DSG9_CITSI; Uncharacterized protein | ||||
TrEMBL | A0A1D6N2M2 | 1e-70 | A0A1D6N2M2_MAIZE; CDC5 protein | ||||
TrEMBL | A0A1S4DSP6 | 2e-71 | A0A1S4DSP6_TOBAC; cell division cycle 5-like protein | ||||
TrEMBL | C1ML82 | 2e-70 | C1ML82_MICPC; Predicted protein (Fragment) | ||||
STRING | evm.model.supercontig_306.1 | 2e-70 | (Carica papaya) | ||||
STRING | XP_003056512.1 | 3e-71 | (Micromonas pusilla) | ||||
STRING | Lus10043451 | 5e-72 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA17957 | 3 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 5e-72 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|