PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016510785.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 176aa MW: 19080.2 Da PI: 6.789 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.6 | 3.7e-58 | 32 | 128 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+eplkvyl++yre+eg XP_016510785.1 32 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYREMEG 126 69********************************************************************************************9 PP NF-YB 96 ek 97 XP_016510785.1 127 SA 128 75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.7E-56 | 27 | 150 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.17E-41 | 35 | 149 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.0E-28 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.7E-21 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.7E-21 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 2.7E-21 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MADGQGSSRS PASPNGGGSH ESGGDQSPRS NVREQDRFLP IANISRIMKK ALPANGKIAK 60 DAKETVQECV SEFISFITSE ASDKCQKEKR KTINGDDLLW AMATLGFEDY IEPLKVYLAR 120 YREMEGSAKT ADGSAKREGM QPSPSSQLAH QGSFSQGMNY GNSQGQHMMV PMQGTD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 5e-48 | 33 | 123 | 3 | 93 | NF-YB |
4awl_B | 5e-48 | 31 | 123 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-48 | 31 | 123 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 6e-48 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 6e-48 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975521 | 2e-83 | HG975521.1 Solanum lycopersicum chromosome ch09, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009767972.1 | 1e-130 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
Refseq | XP_016510785.1 | 1e-130 | PREDICTED: nuclear transcription factor Y subunit B-10-like isoform X3 | ||||
Swissprot | Q8VYK4 | 2e-86 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1S4DBH6 | 1e-128 | A0A1S4DBH6_TOBAC; nuclear transcription factor Y subunit B-10-like isoform X3 | ||||
TrEMBL | A0A1U7VIT3 | 1e-128 | A0A1U7VIT3_NICSY; nuclear transcription factor Y subunit B-10-like isoform X2 | ||||
STRING | XP_009767971.1 | 1e-127 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 8e-89 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|