PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 212aa    MW: 24621.4 Da    PI: 7.2339
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510488.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.14.8e-092568344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+l+ +a  ++  +   +W +Ia++++ g+t++++  ++
   XP_016510488.1 25 TWTRFEDKLFEQALVMYSENdveRWQKIANRVP-GKTAEDVMAHY 68
                     7********************************.********998 PP

2Myb_DNA-binding44.43.9e-14121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_016510488.1 121 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 165
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.5962175IPR017884SANT domain
SMARTSM007171.3E-72274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-52472IPR009057Homeodomain-like
CDDcd001671.09E-72568No hitNo description
PfamPF002491.7E-72568IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-112678IPR009057Homeodomain-like
PROSITE profilePS5129421.268114170IPR017930Myb domain
SuperFamilySSF466893.93E-17116171IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-17117169IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11118164IPR009057Homeodomain-like
SMARTSM007177.3E-11118168IPR001005SANT/Myb domain
CDDcd001673.19E-9121165No hitNo description
PfamPF002494.3E-12121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MMYTTNNRWM IGSDSTATMI HSNSTWTRFE DKLFEQALVM YSENDVERWQ KIANRVPGKT  60
AEDVMAHYDA LVHDVFEIDS GRVDPPSYPD DAFDWESDSK TSQISFGSNK KHEVERKKGT  120
PWTEEEHRLF LIGLDKYGKG DWRSISRNVV VTRTPTQVAS HAQKYYLRQQ SMKKERKRSS  180
IHDITTAVDT KTVPPQNCLQ NQGGYQNFNF PM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1217100285RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0128560.0BT012856.1 Lycopersicon esculentum clone 113942F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009796939.11e-161PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016510488.11e-161PREDICTED: transcription factor DIVARICATA-like
SwissprotQ9FNN63e-58SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A1S4DAV21e-159A0A1S4DAV2_TOBAC; transcription factor DIVARICATA-like
TrEMBLA0A1U7YCH21e-159A0A1U7YCH2_NICSY; transcription factor DIVARICATA-like
STRINGXP_009796939.11e-160(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-74MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]