PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 202aa    MW: 23779.7 Da    PI: 9.5844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510464.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.11.1e-09952344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+l+ +a  +++ g   +W +Ia +++ g++++++  ++
   XP_016510464.1  9 TWTRYEDKLFEEALVMYPEGvvnRWQKIAIHVP-GKSPEDVMAHY 52
                     7********************************.********998 PP

2Myb_DNA-binding445.1e-14112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_016510464.1 112 PWTPEEHRLFLIGLERYGKGDWRSISRNVVVTRTPMQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.7559IPR017884SANT domain
SMARTSM007172.5E-8658IPR001005SANT/Myb domain
PfamPF002498.2E-9852IPR001005SANT/Myb domain
SuperFamilySSF466892.84E-12864IPR009057Homeodomain-like
CDDcd001675.04E-8952No hitNo description
Gene3DG3DSA:1.10.10.604.5E-5956IPR009057Homeodomain-like
PROSITE profilePS5129421.666105161IPR017930Myb domain
SuperFamilySSF466892.08E-17105162IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-16108160IPR006447Myb domain, plants
SMARTSM007173.1E-12109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-12109158IPR009057Homeodomain-like
PfamPF002497.1E-12112156IPR001005SANT/Myb domain
CDDcd001672.04E-9112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MYMIHSTSTW TRYEDKLFEE ALVMYPEGVV NRWQKIAIHV PGKSPEDVMA HYDALVHDVF  60
VIDSGRVDIP SYNHRSSEWE PESGTRTRTS HNISFESNYK NHAEQIRKKG TPWTPEEHRL  120
FLIGLERYGK GDWRSISRNV VVTRTPMQVA SHAQKYFKRQ ESMKKKERKR SSIHDITVDT  180
NILLPQNNNQ NQGVYQNYNF PL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157169KRQESMKKKERKR
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617435.11e-151PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016510464.11e-151PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-50DIV_ANTMA; Transcription factor DIVARICATA
SwissprotQ9FNN61e-50SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A1S4DB831e-150A0A1S4DB83_TOBAC; transcription factor DIVARICATA-like
STRINGXP_009617435.11e-151(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-59MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  3. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]
  4. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]