PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016508913.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 198aa MW: 22854.5 Da PI: 7.5681 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.6 | 8.1e-15 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W +eEde lv +++lG ++W++ a+ g++R++k+c++rw++yl XP_016508913.1 8 RGQWLEEEDESLVMIIAMLGERRWDALAKASGLRRSGKSCRLRWLNYL 55 899*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 46.8 | 6.6e-15 | 65 | 106 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T+ E+ l++++ kq+G++ W++Ia+ ++ gRt++++k++w ++l XP_016508913.1 65 TAGEEHLIIQLQKQFGNK-WSKIAEQLP-GRTDNEIKNYWKSHL 106 788***************.*********.***********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.47 | 3 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.15E-26 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.0E-11 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-13 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-19 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.94E-8 | 11 | 55 | No hit | No description |
PROSITE profile | PS51294 | 25.326 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 8.1E-13 | 60 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.16E-9 | 65 | 106 | No hit | No description |
Pfam | PF00249 | 3.3E-13 | 65 | 106 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MHQDELRRGQ WLEEEDESLV MIIAMLGERR WDALAKASGL RRSGKSCRLR WLNYLRPNLK 60 HGHITAGEEH LIIQLQKQFG NKWSKIAEQL PGRTDNEIKN YWKSHLRKKA LTYKQESFGS 120 NTSNSEQQSS TLKSDTVPSS HSDDSFSGKG DCSSADSLAY SSNDTTLLDW IPSWSYEQSR 180 MEHHMYFCSS NLCFCYPP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 4e-25 | 5 | 110 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 1e-24 | 5 | 110 | 55 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-24 | 5 | 110 | 55 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975449 | 2e-46 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016508913.1 | 1e-147 | PREDICTED: myb-related protein MYBAS1-like isoform X1 | ||||
Refseq | XP_016508914.1 | 1e-147 | PREDICTED: myb-related protein MYBAS1-like isoform X1 | ||||
Refseq | XP_016508915.1 | 1e-147 | PREDICTED: myb-related protein MYBAS1-like isoform X1 | ||||
Refseq | XP_016508916.1 | 1e-147 | PREDICTED: myb-related protein MYBAS1-like isoform X1 | ||||
Swissprot | Q9SCP1 | 4e-48 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A1S4D661 | 1e-146 | A0A1S4D661_TOBAC; myb-related protein MYBAS1-like isoform X1 | ||||
STRING | XP_009592986.1 | 1e-135 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 4e-50 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|