PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016505118.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

YABBY

Protein Properties

Length: 166aa MW: 18667.2 Da PI: 10.3363

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016505118.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	23.4	1.8e-07	39	67	23	51
YABBY 23 avsvPstslfkvvtvrCGhCtsllsvnla 51 +v +P++ l+ +vtv+CGhC++l ++ + XP_016505118.1 39 VVGIPYKRLLDTVTVKCGHCSNLSFLSTR 67 799******************98554444 PP
2	YABBY	97.7	2.7e-30	93	159	94	163
YABBY 94 tsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 + ss s++++ ++p++p v++PPek+ r Psaynrf+k+eiqrika+nP+i hreafsaaaknWa + XP_016505118.1 93 GQSSS---SSSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKDEIQRIKAANPEIPHREAFSAAAKNWARY 159 22222...6677788999999***********************************************75 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	9.9E-42	39	159	IPR006780	YABBY protein
SuperFamily	SSF47095	9.29E-9	103	157	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	4.5E-5	113	158	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 166 aa Download sequence Send to blast
MVSKEGSRRS NDYVQIYSRK KLGESRGHKG GIDFCMHEVV GIPYKRLLDT VTVKCGHCSN 60 LSFLSTRPPL QGQCFDHQSA LQHQTFFSDF KKGQSSSSSS SEPSSPKAPF VVKPPEKKHR 120 LPSAYNRFMK DEIQRIKAAN PEIPHREAFS AAAKNWARYI PNTPNG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY854799	0.0	AY854799.1 Nicotiana tabacum isolate 1 CRABS CLAW mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016505118.1	1e-122	PREDICTED: protein CRABS CLAW-like, partial
Swissprot	Q8L925	1e-53	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A1S4CVI4	1e-121	A0A1S4CVI4_TOBAC; protein CRABS CLAW-like
STRING	XP_009600446.1	7e-91	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA5210	23	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	3e-55	YABBY family protein

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]