PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016502369.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 332aa    MW: 36533.6 Da    PI: 9.3292
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016502369.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.25.1e-201459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell  +v+++G+++W++I++ ++ gR++k+c++rw + 
   XP_016502369.1 14 KGPWSPEEDELLQSLVEKHGPRNWSLISKSVP-GRSGKSCRLRWCNQ 59
                     79******************************.***********985 PP

2Myb_DNA-binding56.46.7e-1868110347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
   XP_016502369.1  68 AFTPEEDETIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 110
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.397964IPR017930Myb domain
SuperFamilySSF466892.55E-3211107IPR009057Homeodomain-like
SMARTSM007176.2E-181362IPR001005SANT/Myb domain
PfamPF002497.6E-201459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-271567IPR009057Homeodomain-like
CDDcd001674.64E-171658No hitNo description
SMARTSM007173.4E-1565113IPR001005SANT/Myb domain
PROSITE profilePS5129421.9366115IPR017930Myb domain
PfamPF002494.0E-1568110IPR001005SANT/Myb domain
CDDcd001671.54E-1268111No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2368114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAAITQRKDS DRIKGPWSPE EDELLQSLVE KHGPRNWSLI SKSVPGRSGK SCRLRWCNQL  60
SPQVEHRAFT PEEDETIIRA HAKFGNKWAT IARLLSGRTD NAIKNHWNST LKRKCCSMSE  120
DLSFETPQQP LKRSSSVGPS TNFSSHMNPG SPSGSDLSDS SLSGFPQPLV YRPVPRTGGL  180
FPLPPPVQQI ETSPFIPDPP TSLCLSLPGS GTRETSNQTA QPTQQTQPPQ SPPLPPSPPL  240
ALPPVDKPVP PPKAAFMPQV PQTKQSYDFC AAALPKSGEK QFFTPEFLGV LQDMIRKEVR  300
NYMSGVEHNG ICMQTDAIRN AVVKRIGISK IE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-40131143104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-391311557159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-391311557159MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-40131143104C-Myb DNA-Binding Domain
1msf_C5e-40131143104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0325400.0AB032540.1 Nicotiana tabacum B19 mRNA for Myb-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795719.10.0PREDICTED: transcription factor MYB44-like
RefseqXP_016502369.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A1S4CN340.0A0A1S4CN34_TOBAC; transcription factor MYB44-like
TrEMBLA0A1U7Y8Y90.0A0A1U7Y8Y9_NICSY; transcription factor MYB44-like
STRINGXP_009795719.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-79myb domain protein 73