PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016498400.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 245aa MW: 27411.6 Da PI: 4.9939 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88 | 5.2e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKA ELSvLCdaeva+iifs tgkl+ey+s XP_016498400.1 9 KKIDNITARQVTFSKRRRGLFKKAAELSVLCDAEVALIIFSATGKLFEYAS 59 68***********************************************86 PP | |||||||
2 | K-box | 46 | 2.3e-16 | 96 | 171 | 24 | 99 |
K-box 24 LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 L ke+ re+R+++Ge+Le Lsl+ Lqq+e++Le +l+++ + K ++++i +lq+k l eenk+L++k++ XP_016498400.1 96 LIKELADKNRELRQMKGEELEGLSLEKLQQIEKRLEAGLTHVLEIKGTKIMDEITKLQRKGAVLMEENKQLKQKMA 171 333333344999*************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.053 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.01E-30 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.2E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.32E-33 | 12 | 77 | No hit | No description |
PRINTS | PR00404 | 5.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.621 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.2E-13 | 95 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAAELSVLCD AEVALIIFSA TGKLFEYASS 60 SMEDILGKYK LHSSSLEKDD QPSLDLQLEN SLNMKLIKEL ADKNRELRQM KGEELEGLSL 120 EKLQQIEKRL EAGLTHVLEI KGTKIMDEIT KLQRKGAVLM EENKQLKQKM AMMNEGELPL 180 LTDLDCMVME EGQSSDQSIT TNVSTSGPPP EDDCSNAFLK LGCNNGPPIE DDCSDTSLKL 240 GLPFN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FN356442 | 1e-107 | FN356442.1 Witheringia solanacea mRNA for MPF2-like (M202 gene), allele WIsoM202_1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016498400.1 | 1e-178 | PREDICTED: MADS-box protein AGL24-like | ||||
Refseq | XP_016498401.1 | 1e-178 | PREDICTED: MADS-box protein AGL24-like | ||||
Swissprot | Q9FVC1 | 9e-83 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1S4CB86 | 1e-176 | A0A1S4CB86_TOBAC; MADS-box protein AGL24-like | ||||
STRING | XP_009627161.1 | 1e-167 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA938 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 2e-76 | MIKC_MADS family protein |