PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016496658.1 | ||||||||
Common Name | NtMYBJS1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 230aa MW: 26145.9 Da PI: 5.4335 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.4 | 1.6e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd+ll+++++++G ++W++ ++ g+ R++k+c++rw +yl XP_016496658.1 14 RGPWSKEEDDLLINYINKHGHPNWRALPKLAGLLRCGKSCRLRWTNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 47.7 | 3.6e-15 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T+eE+ ++++++ lG++ W+ Ia++++ gRt++++k+ w++ XP_016496658.1 67 RGNFTPEEENTIIKLHQVLGNR-WSGIAARLP-GRTDNEIKNIWHT 110 89********************.*********.*********9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.9E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.898 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.14E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.8E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.54E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 24.74 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.7E-26 | 65 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.1E-14 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.87E-9 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MGRAPCCEKL GLKRGPWSKE EDDLLINYIN KHGHPNWRAL PKLAGLLRCG KSCRLRWTNY 60 LRPDIKRGNF TPEEENTIIK LHQVLGNRWS GIAARLPGRT DNEIKNIWHT RLKKRVDDKS 120 QPQETQDIKD QQTMETSKSE ENFETRSSEP ENSKDNSEEI SSPKTNSQIQ EHPNTPSSTL 180 SSGDSCSNTT ATSASSLADE SRDQILLDNL LEVDDNFWSE VLWAPAETND |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-29 | 12 | 117 | 5 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269|PubMed:16861809, ECO:0000269|PubMed:9681014}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269|PubMed:9681014}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB236951 | 0.0 | AB236951.1 Nicotiana tabacum NtMYBJS1 mRNA for methyl jasmonate induced MYB-related transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009770485.1 | 1e-169 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_016496658.1 | 1e-170 | PREDICTED: myb-related protein Myb4-like, partial | ||||
Swissprot | Q9LNC9 | 2e-74 | MYB13_ARATH; Transcription factor MYB13 | ||||
TrEMBL | A0A1S4C6A8 | 1e-168 | A0A1S4C6A8_TOBAC; myb-related protein Myb4-like | ||||
TrEMBL | A0A1U7W8B2 | 1e-168 | A0A1U7W8B2_NICSY; myb-related protein Myb4-like | ||||
STRING | XP_009770485.1 | 1e-169 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06180.1 | 6e-75 | myb domain protein 13 |
Publications ? help Back to Top | |||
---|---|---|---|
|