PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494481.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 275aa    MW: 31820.2 Da    PI: 6.5087
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494481.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl
   XP_016494481.1 15 RGSWTVEEDFTLINHIAIHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding51.62.2e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_016494481.1  68 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0571062IPR017930Myb domain
SuperFamilySSF466892.96E-3012109IPR009057Homeodomain-like
SMARTSM007173.6E-151464IPR001005SANT/Myb domain
PfamPF002492.0E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-211669IPR009057Homeodomain-like
CDDcd001672.67E-111762No hitNo description
PROSITE profilePS5129423.24663117IPR017930Myb domain
SMARTSM007171.3E-1467115IPR001005SANT/Myb domain
PfamPF002494.3E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-2370116IPR009057Homeodomain-like
CDDcd001674.89E-788111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDMQHVNEDH MDLKRGSWTV EEDFTLINHI AIHGEGRWNS LARCAGLKRT GKSCRLRWLN  60
YLRPDVRRGN ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKHAKQL  120
KCDVNSKQFK DTLRYLWMPR LAERIQASSN SAATTTITTT NNSNNNNNNH VSTSVTQENS  180
SVTASSENSM GTQVSPVSDI SDCCYNNYPI NQNDYGELLI SPTGYFQNGA LDFRTVDYNN  240
QQNMSQWMEG TEDVSDNLWN IEDMLFLQQQ LNNDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241210924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt (NaCl). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799770.10.0PREDICTED: transcription factor MYB108-like
RefseqXP_016494481.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9FGY32e-88MYB78_ARATH; Transcription factor MYB78
TrEMBLA0A1S4C0050.0A0A1S4C005_TOBAC; transcription factor MYB108-like
TrEMBLA0A1U7YLQ80.0A0A1U7YLQ8_NICSY; transcription factor MYB108-like
STRINGXP_009799770.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-84myb domain protein 78
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]