PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 294aa    MW: 34548.5 Da    PI: 6.3441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494480.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.5e-183582148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd  l+++++++G g+W++ a++ g++Rt+k+c++rw++yl
   XP_016494480.1 35 KGPWTVEEDFTLINYITLHGEGRWNSLAHCAGLKRTGKSCRLRWLNYL 82
                     79********************************************97 PP

2Myb_DNA-binding51.52.4e-1688131146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_016494480.1  88 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 131
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1213082IPR017930Myb domain
SuperFamilySSF466891.5E-3032129IPR009057Homeodomain-like
SMARTSM007171.0E-143484IPR001005SANT/Myb domain
PfamPF002497.1E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-223689IPR009057Homeodomain-like
CDDcd001671.00E-103782No hitNo description
PROSITE profilePS5129423.24683137IPR017930Myb domain
SMARTSM007171.3E-1487135IPR001005SANT/Myb domain
PfamPF002494.8E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-2390136IPR009057Homeodomain-like
CDDcd001678.14E-7108131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MDHHHVKVGL SSERYGFCSN NNQQLIDEVT MDLRKGPWTV EEDFTLINYI TLHGEGRWNS  60
LAHCAGLKRT GKSCRLRWLN YLRPDVRRGN ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR  120
TDNEIKNYWR TRVQKHAKQL KCDVNSKQFK DTLRYLWMPR LIERIQAAKI PSNSCSEVTQ  180
QPIPNTDINE LELFQVANNN NNNNNNSNPS TSFVSENSSV TPLSDLSDCC YDYPVNQISS  240
ISPDYYQVNH SYRLCYEHSQ ATDQQNIQLW MESEDIFENL WNINEDMWPL EKQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-253213524126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt (NaCl). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009799771.10.0PREDICTED: transcription factor MYB108-like
RefseqXP_016494480.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9FGY38e-88MYB78_ARATH; Transcription factor MYB78
TrEMBLA0A1S4C0070.0A0A1S4C007_TOBAC; transcription factor MYB108-like
TrEMBLA0A1U7YCT60.0A0A1U7YCT6_NICSY; transcription factor MYB108-like
STRINGXP_009799771.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.13e-89myb domain protein 78
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]