PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_016488455.1

Organism

Nicotiana tabacum

Taxonomic ID

4097

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

SBP

Protein Properties

Length: 167aa MW: 19003 Da PI: 9.5744

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016488455.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	128.7	2.3e-40	46	123	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cq+++C+++ls+ak+yh+rhkvCe h+k+++v+v+gl+qrfCqqCsrfhe+ efDe+krsCrrrLa+hnerrrk+++ XP_016488455.1 46 CCQADKCTVNLSDAKQYHKRHKVCEYHAKSQAVVVAGLRQRFCQQCSRFHEVGEFDESKRSCRRRLAGHNERRRKTST 123 6**************************************************************************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.2E-31	40	108	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.223	44	121	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	8.5E-37	45	124	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	4.8E-31	47	120	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MEDNNDLFIL ATDNDDKKKR NPSYNNRSST NNNNEKIKGS STSMRCCQAD KCTVNLSDAK 60 QYHKRHKVCE YHAKSQAVVV AGLRQRFCQQ CSRFHEVGEF DESKRSCRRR LAGHNERRRK 120 TSTTSSSSDQ CNAEVSSSRK SIIGSDTHQI INFQENAAAG YKQFQIG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	7e-37	41	120	5	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KP260635	2e-64	KP260635.1 Nicotiana tabacum SBP-box 4 (SPL4) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009765576.1	1e-121	PREDICTED: squamosa promoter-binding-like protein 3
Refseq	XP_016488455.1	1e-121	PREDICTED: squamosa promoter-binding-like protein 3
Swissprot	Q9S758	4e-42	SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBL	A0A1S4BHV2	1e-120	A0A1S4BHV2_TOBAC; squamosa promoter-binding-like protein 3
TrEMBL	A0A1U7VKT9	1e-120	A0A1U7VKT9_NICSY; squamosa promoter-binding-like protein 3
STRING	XP_009765576.1	1e-120	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA749	24	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15270.1	2e-43	squamosa promoter binding protein-like 5

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]