PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016486565.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 249aa MW: 28903.5 Da PI: 9.6816 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.3 | 1.6e-31 | 25 | 74 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ XP_016486565.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 74 79***********************************************8 PP | |||||||
2 | K-box | 107.8 | 1.2e-35 | 93 | 189 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +s+ s++ea+++++qqe+akL+++i+ +q+ +R+++Ge L+sLs ++L++Le +Lek++ ++RskKnell+++ie +qk+e e+q++n++Lr+k+ XP_016486565.1 93 TSQGSVSEANTQYYQQEAAKLRRQIRDIQTYNRQIVGEALSSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKREIEMQNANMYLRAKI 187 455569****************************************************************************************9 PP K-box 99 ee 100 +e XP_016486565.1 188 AE 189 86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.263 | 17 | 77 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-40 | 17 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.46E-46 | 18 | 94 | No hit | No description |
SuperFamily | SSF55455 | 2.22E-33 | 18 | 93 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-33 | 19 | 39 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 19 | 73 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.4E-27 | 26 | 73 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-33 | 39 | 54 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.6E-33 | 54 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-25 | 101 | 187 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.572 | 103 | 193 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0090376 | Biological Process | seed trichome differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MEFPNEEFES SNSQRKSGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNSVRA TIDRYKKHHA DSTSQGSVSE ANTQYYQQEA AKLRRQIRDI 120 QTYNRQIVGE ALSSLSPRDL KNLEGKLEKA IGRVRSKKNE LLFSEIELMQ KREIEMQNAN 180 MYLRAKIAEV ERAQQQMNLM PGGSEYNHQQ QPMSTSQNYN DARNFLPVNL LEPNHHYSRH 240 DDQTALQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-20 | 18 | 101 | 1 | 86 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ699178 | 0.0 | JQ699178.1 Nicotiana benthamiana shatterproof (SHP) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009762633.1 | 0.0 | PREDICTED: floral homeotic protein AGAMOUS isoform X2 | ||||
Refseq | XP_009762634.1 | 0.0 | PREDICTED: floral homeotic protein AGAMOUS isoform X3 | ||||
Refseq | XP_016486565.1 | 0.0 | PREDICTED: floral homeotic protein AGAMOUS-like isoform X2 | ||||
Swissprot | Q93XH4 | 1e-126 | MADS1_VITVI; Agamous-like MADS-box protein MADS1 | ||||
TrEMBL | A0A1S4BCA5 | 0.0 | A0A1S4BCA5_TOBAC; floral homeotic protein AGAMOUS-like isoform X2 | ||||
TrEMBL | A0A1U7V8C1 | 0.0 | A0A1U7V8C1_NICSY; floral homeotic protein AGAMOUS isoform X2 | ||||
STRING | XP_009762632.1 | 0.0 | (Nicotiana sylvestris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18960.1 | 1e-114 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|