PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016483598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 542aa    MW: 60734.5 Da    PI: 5.8479
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016483598.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS423.32e-1291725421374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+elL++cAeavs+ d + a+ l++ l++++s +g+pm+Rl ay++e+L+arl++s+s +yk+l+++e +   s e l+++++ ++++P++kf++
  XP_016483598.1 172 LKELLYACAEAVSDADISTAEILMNILEQRVSVSGEPMERLSAYVLEGLRARLLSSGSIIYKKLKCKEPT---SLELLSYMQVIYNMCPYYKFAY 263
                     5799*****************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN  I ea+ +e+r+HiiDf+i qG QW+ Ll+ La Rp+gpp +RiTgv++++s   +   l+ +gerLa++A+++gvpfef+  +a +  +
  XP_016483598.1 264 MSANVVIREAMTNENRIHIIDFQIAQGSQWMFLLHDLARRPGGPPFVRITGVDDSQSAhaRGGGLQLVGERLAEVAKSCGVPFEFHG-AALSGCE 357
                     ******************************************************9988889999***********************.8999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L+v++gEalaVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v+++eqe+++n+++Fl rf e+l+yy+a+f+s++a  pr++++ri
  XP_016483598.1 358 VQVENLHVRRGEALAVNFPYMLHHMPDESVSTINHRDRLLRLVKSLSPKIVTLAEQESNTNTAPFLPRFRETLDYYTAMFESIDAARPRDDKQRI 452
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r++vn++acega+r+erhe ++kWr rl++aGF+p pls ++ ++++ +l++++ + yr  e++g+l+lgWk+r+L + SaWr
  XP_016483598.1 453 SAEEHCVARDVVNIIACEGADRVERHELFGKWRLRLMMAGFTPCPLSPSVGETINDMLKEYSPN-YRFAESEGALYLGWKNRALATSSAWR 542
                     **************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.079146523IPR005202Transcription factor GRAS
PfamPF035147.0E-127172542IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MQASQRPQMS GGVHGLYNQP MQQVEQYYAP YHFKNNNCNN TSSVTQFTFQ TQNEHFFTLD  60
SLPATDYVVY DSPTALSVSS NRSPFSPQCS QSYMSDLHHS SDNNTCGSPF SGCSGVDDGD  120
LKHVLRELEN KLLGPESDTD DSCSCSFNDV VSKPSSLTRW NQVLDMAPSL NLKELLYACA  180
EAVSDADIST AEILMNILEQ RVSVSGEPME RLSAYVLEGL RARLLSSGSI IYKKLKCKEP  240
TSLELLSYMQ VIYNMCPYYK FAYMSANVVI REAMTNENRI HIIDFQIAQG SQWMFLLHDL  300
ARRPGGPPFV RITGVDDSQS AHARGGGLQL VGERLAEVAK SCGVPFEFHG AALSGCEVQV  360
ENLHVRRGEA LAVNFPYMLH HMPDESVSTI NHRDRLLRLV KSLSPKIVTL AEQESNTNTA  420
PFLPRFRETL DYYTAMFESI DAARPRDDKQ RISAEEHCVA RDVVNIIACE GADRVERHEL  480
FGKWRLRLMM AGFTPCPLSP SVGETINDML KEYSPNYRFA ESEGALYLGW KNRALATSSA  540
WR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-6217954126378Protein SCARECROW
5b3h_A9e-6317954125377Protein SCARECROW
5b3h_D9e-6317954125377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773976.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_016483598.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A1S4B4900.0A0A1S4B490_TOBAC; scarecrow-like protein 13
TrEMBLA0A1U7W9T50.0A0A1U7W9T5_NICSY; scarecrow-like protein 13
STRINGXP_009773976.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13